IMGT Repertoire (IG and TR)

Only the *01 allele of each functional, ORF and in-frame pseudogenes C-REGION is shown.

Letters in red correspond to amino acids which are polymorphic in the other alleles.
For C-REGIONs, letters in bold correspond to additional positions in the IMGT unique numbering.
For C-REGIONs, letters between parentheses correspond to amino acids resulting from the splicing.

Dots indicate gaps according to the IMGT unique numbering. Blanks at the 5' and/or 3' end indicate partial sequences.

Only functional, ORF and in-frame pseudogenes are shown.

Functionality is shown between:
- parentheses, (F) and (P), when the accession number refers to rearranged genomic DNA or cDNA and the corresponding germline gene has not yet been isolated.
- brackets, [F] and [P], when the accession number refers to genomic DNA, but not known as being germline or rearranged.

N (Asn, asparagine) of potential N-glycosylation sites (NXS/T, where X is different from P), (N-linked glycosylation) is shown is green (site is underlined in CHS and in pages edited before 14/10/2009).

The TRGC protein display numbering is according to the IMGT unique numbering for C-DOMAIN and C-LIKE-DOMAIN.

				
                    A        AB     B           BC         C     CD      D          DE           E      EF   F          FG            G              CHS
                 (1-15)          (16-26)     (27-38)    (39-45)       (77-84)                 (85-96)     (97-104)   (105-117)    (118-128)   
             ——————————————>   ——————————> ———————————> ——————>       ———————>              ———————————>  ———————> ————————————> ——————————>  
C GenesAccNum
             1        10  15   16  20 2326 27        38 3941 45       77 80 84              85  89    96  97   104 105       117 118121     130       140      150
     87654321|........|....|123|...|..|..| |..........| |.|...|1234567|..|...|12345677654321|...|......|12|......| |...........| |..|........|.........|.........|
EX1
TRGTRGC1*01D90409 F #c (1)
   (E)RNLEADTSPKPTVFLPSIAEINH..DNAGTYLCLLE KFFP....DVIT VSWRAKNDKRAL..PSQQGNTMKTKD.......TYMKFSWLTVTEN....SMDKQHVC VVKHKKNIGGIDQ EIIFPSIKE
TRGC2*01D90411 F #c (2)
   (E)RNLEADTSPKPTVFLPSIAEINH..DNAGTYLCLLE KFFP....DVIT VSWRAKNDKRAL..PSQQGNTMKTKD.......TYMKLSWLTVTEN....SMDKQHVC VVKHKKNIGGIDQ EIIFPSIKE
TRGC3*01D90414 F #c
   (D)RDLDIDMSPKPTMFLPSITEIKR..ENTGTYLCLLE NFFP....HVIK VYWREKRGNRVL..PSQQGNTVKTAD.......TYMKFSWLTVSGN....SMDKEHIC IVKHEKNKTGDNQ EILFPPVNE
TRGC4*01X63680 F #c
   (D)RNLATDISPKPTIFLPSIAEINH..SKTGTYLCLLE KFFP....DIIK VYWKEKDGNKAL..PSQQGNTMKTTD.......TYMKLSWLTVTEN....SMDKEHIC VVQHERNIGGINQ EILFPSINE
EX2 & EX3
                    [EX2A]                      [EX2B]               [EX2C]                         [EX3]
TRGTRGC1*01D90409 F #c
   (V)VTSLVPTTEPPTTKPPTTEPPTTEPPNDCLTDES (K)LTGTGSKKACLKDGS     (D)TNSTKACLEGES (S)TLQLQLMNTSAAYYTYLLLLFLSTVYFVVIISCVFRRTGVC
TRGC2*01D90411 F #c
   (V)VTSLVPTTEPPTA..........EPPNDCLTDES  (I)TDTGSKKACLKDGS     (D)TNSTKACLEGKS (S)TLQLQLMNTSAAYYTYLLLLLLSTVYFAVIISCVFRRTGVCCDRKIS
TRGC3*01D90414 F #c
   (V)VTSVVTATKPP...............NDGLKDKK                    (K)QVPVVNSTKACLKDEN (N)TLQLHLMNTSA.YYTYLLLLITSTVYLVIITSCVFRRTGVCGIQKSS
TRGC4*01X63680 F #c
   (V)VSSIVPTTESP...............SDCLNHDS (K)VTGTGSKKACLKDES (E)VTADNNSTKVCLKDES (N)TLQLQLMNTSA.YYTYLLLLLKSVVYCIIITSCVFRRTGICCDGKNL
                                               CONNECTING_REGION                                |TRANSMEMBRANE-REGION| CYTOPLASMIC-REGION

#c: rearranged cDNA

IMGT notes:
(1) The sequence described in the manuscript is different from the one submitted to the EMBL data library. Nucleotide t at position 738 in EMBL flat file (codon 20 in EX3) which may represent a submission error, nucleotide c in the manuscript (F20>L). Nucleotides gc (positions 804-805 in EMBL flat file (codon 42 in EX3) which may represent a submission error, nucleotides tg in the manuscript (V42>C)
(2) The sequence described in the manuscript is different from the one submitted to EMBL: DELETION of 1 nucleotide a (between positions 440-441) which may represent a submission error leading to a frameshift.