Protein display: Horned shark (Heterodontus francisci) IGH C-REGIONs

The IGHC protein display numbering is according to the IMGT unique numbering for C-DOMAIN and C-LIKE-DOMAIN.

Only the *01 allele of each functional, ORF and in-frame pseudogenes C-REGION is shown.

N (Asn, asparagine) of potential N-glycosylation sites (NXS/T, where X is different from P), (N-linked glycosylation) is shown is green (site is underlined in CHS and in pages edited before 14/10/2009).

_____________________________________________________________________________________________________________________________________________________________________________________________

      IGHC

      genes
_____________________________________________________________________________________________________________________________________________________________________________________________

                                A                 B         BC         C               D                     E              F               G

                         --------------->    ---------->             ----->        ----------->       -------------->  ------------->   ---------->

                          1       10   15  16  20 23      30    36 39 41 45      77     84             85  89     96 97    104   110 114   120       130       140       150

                   7654321|........|....|123|...|...... ...|.....|  |.....|1234567|......|12345677654321|..........|12|............|...|.....|.........|.........|.........|

  CH1
  X07781  ,IGHM1    (A)TPSPPTLYGLCSCEQPNT...DGSLAYGCLAM DYIP..QITS  VSWKKDNEPITT..GLKTYPSVLNKK......GTYTQSSQLTITESE...VGSSKIYCEVRRG....ESVWIKEIP
  X07782  ,IGHM2c                                                          EPITT..GLKTYPSVLNKK......GTYTQSSQLTITESE...VGSSKIYCEVRRG....ESVWIKEIP
  X07783  ,IGHM3c                                                                                         SQLTITDSE...VGSSKIYCEVRRG....ESLWIKEIP
  X07784  ,IGHM4c   (A)TPSPAILYGLCSCEQTNT...DGSLAYGCLAM DYSP..EITS  ITWKKDKEPITT..GLKIYPSVLNKK......GTYTRSSQLTITESE...VGSSKIYCEVRRG....ESLWIKEIL  
  M17184  ,IGHM5    (A)TPSPPTLYGLCSCEQPNT...DGSMAYGCLAM DYIP..QITS  VSWKKGKEPITT..GLKTYPSVLNKK......GTYTLSSQLTITESE...VGSSKIYCEVRRG....ESLWIKEIP  
  M17187  ,IGHM6    (A)TPSPPTLYGLCSCEQPNT...DGSMAYGCLAM DYIP..QITS  VSWKKDNEPITT..GLKTYPSVLNKK......GTYTQSSQLTITESE...VGSSKIYCEVRRG....ESVWIKEIP  
  M17185  ,IGHM7    (A)TPSPPTLYGLFSSCEQPNT..DSSVAYGCLAM DYTP..EITT  VSWKKDKEPITT..GLKNYSSVLNKK......GTYTLSSQLTITESE...VGSSKIYCEVRRG....ESVWIKEIP  
  M17788  ,IGHM8    (A)TLSPPTLFVLLSSYEQPNT..GGSMTYGCLAM DYSP..EITT  VSWKKDKEPIST..GLETYPSVLNKK......GTYTQCGQLTITESE...VGSSKIYCEVRRG....ESVYCSGDMNSKMP
  CH2
  X07781  ,IGHM1 (D)CKGDKVHPTVILTQSSSEEITS..RRFATVLCSII DFHP..ESIT  VSWLKDGQHMES..GFVTSPTCGVNG.......TFSATSRLTVPAREW..FTNKVYTCQVSHQ....GVTQSRNITGSQ
  X07782  ,IGHM2c(D)CKGDKVHPTVILTQSSSEEITS..RRFATVLCSII DFHP..ESIT  VSWLKDGQHMES..GFVTSPTCGVNG.......TFSATSRLTVPAREW..FTNKVYTCQVSHQ....GVTQSRNITGSQ
  X07783  ,IGHM3c(D)CKGDIVHPTVILTQTSSEEITS..SRFATVVCSII DFHP..EAIT  VNWLKDGHPMES..GFVTSPACETNG.......NFSATSRLTVPAREW..FTNTVYTCQVSHQ....AATQSRNITGSP  
  X07784  ,IGHM4c(D)CKGDIVPPTVILTQSSSEEITS..RRFATVLCSII DFHP..ESIT  VSWLKDGQPMDS..GFVTSPTCEVNG.......NFSATSRLTVPAGEW..FSNTVYTCQVAHQ....EVTQSRNITGSQ

  CH3
  X07781  ,IGHM1  (V)PCSCNDPVIKLLPPSIEQVLL..EATVTLTCVVS NAPY...GVN  VSWTQEQKSL....KSEIAVQPGED........ADSVISTVNISTQAW..LSGAEFYCVVNHQD..LPTPLRASIHKEE
  X07782  ,IGHM2c (V)PCSCNDPVIKLLPPSIEQVLL..EATVTLNCIVS NAPY...GVN  VSWTQEQKSL....KSEIAVQPGED........ADSVISTVNISTQAW..LSGAEFYCVVNHQD..LPTPLRASIHKEE  
  X07783  ,IGHM3c (D)SSECNHPAIKLLPPSIEQVLL..EATVTLTCVVS NAPY...GVN  VSWTQEQKPL....KSEIAVQPGED........PDSVISTVDISTQAW..LSEAVFYCVVSHQD..LPTPLRDSIHKEA  
  X07784  ,IGHM4c (V)PCSIGDPVIKLLPPSIEQVLL..EATVTLTCVVS NAPY...GVN  VSWTQEKKPL....KSEIAVQPGED........SDSVISTVNISTQAW..LSGAEFYCVVSHQD..LPTPLRASIHKEE  
  X07785  ,IGHM9c                 PSIEQVLL..EATVTLTCVVS NAPY...GVN  VSWTQEQKPL....KSEIAVQPGED........SDSVISTVDISAQSW..LSGVDFYCVVSHQD..LPTPLRDFIHKEK
  CH4
  X07781  ,IGHM1   (V)KDLREPSVSILLSPAEDVSA..QRFLSLTCLVR GFFP..REIF  VKWTVNDKSVNPG.NYKNTEVMAENDN.....SSYFIYSLLSIAAEEW..ASGASYSCVVGHEA.IPLKIINRTVNKSSGKPSFVNISLALLDTVNSCQ
  X07782  ,IGHM2c  (V)KDLREPSVSILLSPAEDVSA..QRFLSLTCLVR GFSP..REIF  VKWTINDKSVNPG.NYKNTEVMAENDN.....SSYFIYSLLSIAAEEW..ASGASYSCVVGHEA.IPLKIINRTVNKSSGKPSFVNISLALLDTVNSCQ  
  X07783  ,IGHM3c  (W)KDLREPSVSVLLPPAEEISA..ERFLSLTCLVR GFSP..REIF  VKWTVNDKSVNPG.NYKNTEVMAENDK.....SSFFIYSLLSIAAEEW..ASGASYSCVVGHEA.IPLKIINRTVNKSSGKPSFVNISLALLDTVNSCQ    
  X07784  ,IGHM4c  (V)KDLREPFVSVLLPPAEDVSA..QRFLSLTCLVR GFSP..REIF  IKWTVNDKSVNPG.NYKNTEVMAENDN.....RSFFIYSLLSIAAEEW..ASGASYSCVVGHEA.IPLKIINRTVNKSSGKPSFVNISLALLDTVNSCQ  
  X07785  ,IGHM9c  (N)KDLREPSVSVLLPPADDVSA..QRFLSLTCLVR GFSP..REIF  VKWTVNDKSVNPG.NYKNTEVMAENDN.....SSYFIYSLLSIAAEEW..ASGASYSCVVGHEA.IPLKIINRTVNKSS  

                                       M1                        M2
  X07781  ,IGHM1     (D)SSDHIWIEDNEEESAIDNASTFIILFFLSIFYRAAVTLVK  VK
                                        M
  X07785  ,IGHM9c  (D)SSDHIWIEDNEEESGNIWTTASTFIILFFLSIFYSAAVTLVK  VK  
                    CONNECTING_REGION |    TRANSMEMBRANE-REGION    |CYTOPLASMIQUE REGION

c: cDNA sequence


Last updated: Friday, 27-May-2016 21:03:27 CEST
Created: 20/03/2003
Author: Dominique Scaviner

Software material and data coming from IMGT server may be used for academic research only, provided that it is referred to IMGT®, and cited as "IMGT®, the international ImMunoGeneTics information system® http://www.imgt.org (founder and director: Marie-Paule Lefranc, Montpellier, France)." References to cite: Lefranc, M.-P. et al., Nucleic Acids Res., 27:209-212 (1999); doi: 10.1093/nar/27.1.209 Full text Cover; Ruiz, M. et al., Nucleic Acids Res., 28:219-221 (2000); doi: 10.1093/nar/28.1.219 Full text; Lefranc, M.-P., Nucleic Acids Res., 29:207-209 (2001); doi: 10.1093/nar/29.1.207 Full text; Lefranc, M.-P., Nucleic Acids Res., 31:307-310 (2003); doi: 10.1093/nar/gkg085 Full text; Lefranc, M.-P. et al., In Silico Biol., 5, 0006 (2004) [Epub], 5:45-60 (2005); Lefranc, M.-P. et al., Nucleic Acids Res., 33:D593-597 (2005); doi: 10.1093/nar/gki065 Full text; Lefranc, M.-P. et al., Nucleic Acids Res., 37:D1006-1012 (2009); doi: 10.1093/nar/gkn838 Full text; Lefranc, M.-P. et al., Nucleic Acids Res., 43:D413-422 (2015); doi: 10.1093/nar/gku1056 Full text.
For any other use please contact Marie-Paule Lefranc Marie-Paule.Lefranc@igh.cnrs.fr.

CNRS Université de Montpellier European Commission
IMGT® Founder and Executive Director Emeritus:
Marie-Paule Lefranc Marie-Paule.Lefranc@igh.cnrs.fr
IMGT® Director:
Sofia Kossida Sofia.Kossida@igh.cnrs.fr
Bioinformatics manager:
Véronique Giudicelli Veronique.Giudicelli@igh.cnrs.fr
Computer manager:
Patrice Duroux Patrice.Duroux@igh.cnrs.fr
Webmaster:
Amélie Houles

Citing IMGT | Warranty disclaimer and copyright notice | Privacy policy and advertisement policy

© Copyright 1995-2017 IMGT®, the international ImMunoGeneTics information system®