Protein display: Little skate (Leucoraja erinacea) IGH C-REGIONs

The IGHC protein display numbering is according to the IMGT unique numbering for C-DOMAIN and C-LIKE-DOMAIN.

Only the *01 allele of each functional, ORF and in-frame pseudogenes C-REGION is shown.

N (Asn, asparagine) of potential N-glycosylation sites (NXS/T, where X is different from P), (N-linked glycosylation) is shown is green (site is underlined in CHS and in pages edited before 14/10/2009).

_____________________________________________________________________________________________________________________________________________________________________________________________

      IGHC
      genes
_____________________________________________________________________________________________________________________________________________________________________________________________

                                A                 B         BC         C               D                     E              F               G

                         --------------->    ---------->             ----->        ----------->       -------------->  ------------->   ---------->

                          1       10   15  16  20 23      30    36 39 41 45      77     84             85  89     96 97    104   110 114   120       130       140       150

                   7654321|........|....|123|...|...... ...|.....|  |.....|1234567|......|12345677654321|..........|12|............|...|.....|.........|.........|.........|

  CH1
  M29679  ,IGHM1 c  (A)APSAPSPFILFTCEDQGS...SGSFTYGCLAL GYSP..AGAS  VSWKKDDIKLET..GVKGYPAVFNKL......GTYTRSSELTITEAA...AAGGDIFCVVQHN....HNEYKVKVQLP  
  M29676  ,IGHM2       APSAPSLFILFTCEDHGS...SGSFTYGCLVL GYSP..AGAS  VSWKKDDKQLTT..GVKDYPAVFNKL......GTYTRSSELTIAEAE...AGRGDIVCVVQHD....QKEYETPLP
  M29672  ,IGHR1 c  (E)DVVLPSVHITSSCNTES....GQEISILCLVK DYLP..EVIS  QTWSTSSGVINN..GITKYPPVLGQN......KKYTMSSLLRVSVADW...NRKTYYCKAGYKP...DNMVKTEIQK
  CH2
  M29679  ,IGHM1 c (D)RVVHHPTVTITITALDEIKR..QGKAIAVCLVN DFTP..AIFT  VNWLKNGKPLDS..GIVTSPAFQVNGT.....GNFSATSQLTFTAEEW..FGDFVYTCQVNHE....KDLKSQNISMPP  
  M29674  ,IGHM2   (E)LAVQHPTVTIAITAHDEIKR..SKKAIAVCLVN DFTP..AKFT  VNWLKNGAPLDS..DIVTSPAFQVNGN.....GNFSATSQLTFPAGEW..FSGSVYTCQVDHG....KYLKSQNISRPG  
  M29672  ,IGHR1 c    (P)QAPQLIPLVPSPETLHN..QTTAVLGCMIS GFSP..DNIK  VSWKKAGLNQA...GVVLPSTPRTNG.......GFETVAYLPLNVEEW..TNKQEYTCEVTHAP..SGFSDKINMRYQEGGKCPGCSKCLPKFIYQSNLNVSFSDGSTQQYHCWAGKCEIK
  CH3
  M29679  ,IGHM1 c (D)VSCDKLSITILPPQVEQELM..EMTVTLTC.LV SDAP..YGIT  VSWKRGNVPL....VSYIQPTGPA..........DIVQSKVNISTQDW..LSGDYFECAVSHAD..MPKPKTERINWKK  
  M26675  ,IGHM5     GIPCVDLKITMLPPPVEQELM..EMTVTLTCYRV SHAP..YGIT  VSWSHMKKHL....ESEIQPTGHE..........DIVESKVNISTRDW..LSGDYFECEVSHDE..MPTPKTGRINWNK

  CH4
  M29679  ,IGHM1 c (G)QHLLPPSVSVLLPPTEEISA..HKTITLTCFVR GFSP..RRVF  VTWTLDDKRVDES.KYKNTEVEAENGN.....DTFFTYSLLSVGAEEW..ASGASFSCLVGHEA.LPMKTIVRTVNKSSGKPSFVNVSLVLMDTVNSCQ  
  M26677  ,IGHM6      QHLLPPSVSILLPPTEEISA..HKTITLTCFVR GFSP..RRVF  VTWTLDDKRVDES.KYKNTEVVAENGN.....DTFFTYSLLSIGAEEW..ASGASFSCLVGHEA.LPMKTIVRTVNKSSGKPSFVNVSLVLMDTVNSCQ 
  

                                             M1                    M2
  M29678  ,IGHM6      YADNVPLEDYEEDRDNIWTTASTFIILFFLSISYGAAVTLVK  VK
                     CONNECTING_REGION| TRANSMEMBRANE-REGION      |CYTOPLASMIQUE REGION
c: cDNA sequence


Created: Friday, 27-May-2016 21:03:27 CEST
Author: Dominique Scaviner

Software material and data coming from IMGT server may be used for academic research only, provided that it is referred to IMGT®, and cited as "IMGT®, the international ImMunoGeneTics information system® http://www.imgt.org (founder and director: Marie-Paule Lefranc, Montpellier, France)." References to cite: Lefranc, M.-P. et al., Nucleic Acids Res., 27:209-212 (1999); doi: 10.1093/nar/27.1.209 Full text Cover; Ruiz, M. et al., Nucleic Acids Res., 28:219-221 (2000); doi: 10.1093/nar/28.1.219 Full text; Lefranc, M.-P., Nucleic Acids Res., 29:207-209 (2001); doi: 10.1093/nar/29.1.207 Full text; Lefranc, M.-P., Nucleic Acids Res., 31:307-310 (2003); doi: 10.1093/nar/gkg085 Full text; Lefranc, M.-P. et al., In Silico Biol., 5, 0006 (2004) [Epub], 5:45-60 (2005); Lefranc, M.-P. et al., Nucleic Acids Res., 33:D593-597 (2005); doi: 10.1093/nar/gki065 Full text; Lefranc, M.-P. et al., Nucleic Acids Res., 37:D1006-1012 (2009); doi: 10.1093/nar/gkn838 Full text; Lefranc, M.-P. et al., Nucleic Acids Res., 43:D413-422 (2015); doi: 10.1093/nar/gku1056 Full text.
For any other use please contact Marie-Paule Lefranc Marie-Paule.Lefranc@igh.cnrs.fr.

CNRS Université de Montpellier European Commission
IMGT® Founder and Executive Director Emeritus:
Marie-Paule Lefranc Marie-Paule.Lefranc@igh.cnrs.fr
IMGT® Director:
Sofia Kossida Sofia.Kossida@igh.cnrs.fr
Bioinformatics manager:
Véronique Giudicelli Veronique.Giudicelli@igh.cnrs.fr
Computer manager:
Patrice Duroux Patrice.Duroux@igh.cnrs.fr
Webmaster:
Amélie Houles

Citing IMGT | Warranty disclaimer and copyright notice | Privacy policy and advertisement policy

© Copyright 1995-2017 IMGT®, the international ImMunoGeneTics information system®