Protein display: African lungfish (Protopterus aethiopicus) IGH C-REGIONs

The IGHC protein display numbering is according to the IMGT unique numbering for C-DOMAIN and C-LIKE-DOMAIN.

Only the *01 allele of each functional, ORF and in-frame pseudogenes C-REGION is shown.

Letters in red correspond to amino acids which are polymorphic in the other alleles.
For C-REGIONs, letters in bold correspond to additional positions in the IMGT unique numbering.
For C-REGIONs, letters between parentheses correspond to amino acids resulting from the splicing.

N (Asn, asparagine) of potential N-glycosylation sites (NXS/T, where X is different from P), (N-linked glycosylation) is shown is green (site is underlined in CHS and in pages edited before 14/10/2009).

_____________________________________________________________________________________________________________________________________________________________________________________________

      IGHC
      genes
_____________________________________________________________________________________________________________________________________________________________________________________________
                                            A        AB     B          BC         C      CD     D          DE           E      EF   F            FG          G
                                     -------------->   ---------->             ------>       ------->              ----------->  ------->               ---------->
                                     1       10   15  16  20 23      30    36 39 41 45      77     84             85  89     96 97    104    110      118  121    130       140       150
                              7654321|........|....|123|...|...... ...|.....|  |.....|1234567|......|12345677654321|..........|12|....... .....|....... ..|.........|.........|.........|

  CH1
c AF437724,IGHM	                 AQKAAPTVFPVASCSEPSP...DGFISLGLLAT EFLP..NDVS  FTWRSQLSIDAS..LFLPKTYPSVISA....KGTYIGSSQLLLPFTEC..QKPNNIFC EVKHS....LGEK VYSVICP
c AF437727,IGHW	                 ATPSGPSVYPVSPCCDVQKS..QDPLKIGCFVT ADSP...SDN  IQWFLGSSQISS..GVTQYPEVYSNG.......RYSLSSVLNLKSADW...NDKSYEC RFGTQ...KKPVQ KRGCKED
  CH2
c AF437724,IGHM	                DFTVILPKVSIFLPATQE.....STFINLVCLVE GFRP..KNAK  VTWSKNRQPVNT..GVLTFATVLDEN......KNFTTTSSLRITREDW..NKEAEFMC QASHPR..WNETV TKNISKPLV
c AF437727,IGHW	                 CPNKIPKIELYMASCEPDD...PKNMYLFCDLS DFAP..EDIE  VAWFRGTSTVT...DFITIGNVTEVNK.....CSFHTSSKLKLVPEDW..SNGMEYKC LATHS....TKSV EKKISSCTA
  CH3
c AF437724,IGHM	               PGSTLEDVKVIGIAPSIEDILL..AKSAHVSCLVY GLLSP.ENCN  ISWARSSEPKKS..FKFPFEEIPNEN......GTFSIISKMPICPAEW..NSEEEFTC IVEHES..LPTPE RVTIKKHNG
c AF437727,IGHW	                 CPKPSPTIELMKSSYRDFFT..KKKGTLTCNVT SFLK..NTIV  ILKQDNRDLV....KKQLSSSEATGN......GTWNVHISFDISEADW....RKTFIC EAQHT....CKTD KKTLN
  CH4
c AF437724,IGHM	                 GILKKPKIVLLPPTSEDLSN..SETVTLTCLVK GFSP..ADLF  LKWHHNGAPVPD..AEYSDTNKLQDAG....NESFSMYSKLEIRVEDW..NNGHSFTC IVGHE....SLDL NVSSKTIDKSSGKPSSVNVTVIMSDTAGAY
c AF437727,IGHW	                  PEETKEQKKPSVKIHKAVS..SIFNTLICIIS GYYP..DEIF  VKWEQNGHPGNT..EASTHPAVYDKAS.....KSYTMQSILLIPIEDV..KEASIWSC MVGHSALSEMMSD STEVKPF       
  CH5
c AF437727,IGHW	                AQPKVPPTVAISEPSADENN...EQRLNIDCIAY GFFP..KNIA  IQWLSQEPKKL...LVKTFDVELGES......GTYSIKSILNLSKEEW...HEGQFTC DVKHEA..TKTRI LRNTTNTHACS 
  CH6
c AF437727,IGHW	                 EYMAAPDVYTIKPSYEDIVI..NRKATLTCLVV GYEL..DSVN  ITWTENDSLIT...DGISSNTEIHSN......GTETVKGLLGIPADDW..LNGRKYSC KVAHSA..LPTPK LMDMWFEEGST
  CH7
c AF437727,IGHW	              ETKSKTRAPEVNLRLPTPEEVKK..DENLTLICLIE NYFP..DYVF  VQWRENNTRIHSS.NYRNSDSYFNQKT.....NAYTMDSKLVVQTKDW..DEGKTYTC MVNH.....ISST WTIFKEGNKHTGKPTTVNLSVYLTEGKRECHV

                               M1                                M2
c AF437735,IGHM                       EHVYIVENVADDDSDSLWSTASTFIILFLISLLYSAGVTVFK VK                               
                                   CONNECTING_REGION  |  TRANSMEMBRANE-REGION | CYTOPLASMIC-REGION
c: cDNA sequence

IMGT note:
5' and 3' end of exons need to be confirmed with genomic sequence.


Created: 23/07/2003
Author: Nathalie Bosc

Software material and data coming from IMGT server may be used for academic research only, provided that it is referred to IMGT®, and cited as "IMGT®, the international ImMunoGeneTics information system® http://www.imgt.org (founder and director: Marie-Paule Lefranc, Montpellier, France)." References to cite: Lefranc, M.-P. et al., Nucleic Acids Res., 27:209-212 (1999); doi: 10.1093/nar/27.1.209 Full text Cover; Ruiz, M. et al., Nucleic Acids Res., 28:219-221 (2000); doi: 10.1093/nar/28.1.219 Full text; Lefranc, M.-P., Nucleic Acids Res., 29:207-209 (2001); doi: 10.1093/nar/29.1.207 Full text; Lefranc, M.-P., Nucleic Acids Res., 31:307-310 (2003); doi: 10.1093/nar/gkg085 Full text; Lefranc, M.-P. et al., In Silico Biol., 5, 0006 (2004) [Epub], 5:45-60 (2005); Lefranc, M.-P. et al., Nucleic Acids Res., 33:D593-597 (2005); doi: 10.1093/nar/gki065 Full text; Lefranc, M.-P. et al., Nucleic Acids Res., 37:D1006-1012 (2009); doi: 10.1093/nar/gkn838 Full text; Lefranc, M.-P. et al., Nucleic Acids Res., 43:D413-422 (2015); doi: 10.1093/nar/gku1056 Full text.
For any other use please contact Marie-Paule Lefranc Marie-Paule.Lefranc@igh.cnrs.fr.

CNRS Université de Montpellier European Commission
IMGT® Founder and Executive Director Emeritus:
Marie-Paule Lefranc Marie-Paule.Lefranc@igh.cnrs.fr
IMGT® Director:
Sofia Kossida Sofia.Kossida@igh.cnrs.fr
Bioinformatics manager:
Véronique Giudicelli Veronique.Giudicelli@igh.cnrs.fr
Computer manager:
Patrice Duroux Patrice.Duroux@igh.cnrs.fr
Webmaster:
Amélie Houles

Citing IMGT | Warranty disclaimer and copyright notice | Privacy policy and advertisement policy

© Copyright 1995-2017 IMGT®, the international ImMunoGeneTics information system®