Protein display overview: Mammals (Mammalia) IGH C-REGIONs

The IGHC protein display numbering is according to the IMGT unique numbering for C-DOMAIN and C-LIKE-DOMAIN.

Letters in red correspond to amino acids which are polymorphic in the other alleles.
For C-REGIONs, letters in bold correspond to additional positions in the IMGT unique numbering.
For C-REGIONs, letters between parentheses correspond to amino acids resulting from the splicing.

N (Asn, asparagine) of potential N-glycosylation sites (NXS/T, where X is different from P), (N-linked glycosylation) is shown is green (site is underlined in CHS and in pages edited before 14/10/2009).

_____________________________________________________________________________________________________________________________________________________________________________________________

      IGHC
      genes
_____________________________________________________________________________________________________________________________________________________________________________________________
                                             A        AB     B          BC         C      CD     D          DE           E      EF   F            FG          G             CHS
                                      -------------->   ---------->             ------>       ------->              ----------->  ------->               ---------->
                                      1       10   15  16  20 23      30    36 39 41 45      77     84             85  89     96 97    104    110      118  121    130       140       150
                               7654321|........|....|123|...|...... ...|.....|  |.....|1234567|......|12345677654321|..........|12|....... .....|....... ..|.........|.........|.........|
       CH1
Homsap J00220  ,IGHA1           (A)SPTSPKVFPLSLCSTQP....DGNVVIACLVQ GFFPQ.EPLS  VTWSESGQGV....TARNFPPSQDASG.....DLYTTSSQLTLPATQC..LAGKSVTC HVKHY...TNPSQ DVTVPCP
Homsap J00221  ,IGHA2           (A)SPTSPKVFPLSLDSTPQ....DGNVVVACLVQ GFFPQ.EPLS  VTWSESGQNV....TARNFPPSQDASG.....DLYTTSSQLTLPATQC..PDGKSVTC HVKHY...TNPSQ DVTVPCP
Macfas X53705  ,IGHA            (A)SPTRPKVFPLSLEGTQ.....SDNVVVACLVQ GFFPQ.EPLN  VTWSKSGAGV....TVINFPPSQDASG.....GLYTTSSQLTLPAAQC..PARESVTC HVEHY...TNPSQ DVAVPC
Macmul AY039245,IGHA            (A)SPTKPKVFPLSLEGTQ.....SDNVVVACLVQ GFFPQ.KPLN  VTWSKSGAGV....TVINFPPRQDASG.....GLYTTSSQLTLPAAQC..PASESVTC HVEHY...TNPRQ DVAVPCR
Pantro X53702  ,IGHA1           (A)SPTSPKVFPLSLDSNPQ....DGNVVVACLVQ GFFPQ.EPLS  VTWSESGQGV....TATNFPPSQDASG.....DLYTTSSQLTLPATQC..LAGKSVTC HVKHY...TNPSQ DVTVPCR
Pantro X53706  ,IGHA2           (A)SPTSPKVFPLSLDSNPQ....DGNVVVACLVQ GFFPQ.EPLS  VTWSESGQNV....TATNFPPSQDASG.....DLYTTSSQLTLPATQC..LAGKSVTC HVTHY...TNPSQ DVTVPCR
Canfam L36871  ,IGHA            (E)SKTSPSVFPLSLCHQES....EGYVVIGCLVQ GFFPP.EPVN  VTWNAGKDST....SVKNFPPMKAATG.....SLYTMSSQLTLPAAQC..PDDSSVKC QVQHA...SSPSK AVSVPCK
Musmus J00475  ,IGHA            (E)SARNPTIYPLTLPPVLC....SDPVIIGCLIH DYFPF.GTMN  VTWGKSGKDI....TTVNFPPALASG......GRYTMSSQLTLPAVEC..PEGESVKC SVQHD...SNPVQ ELDVNCS
Bostau AF109167,IGHA            (E)SETSPSIFPLSLGNNDP....AGQVVIGCLVQ GFFPS.APLS  VTWNQNGDSV....SVRNFPAVLAGS.......LYTMSSQLTLPASLC..PKGQSVTC QVQHL...SKASK TVAVPCIIQ
Oviari AF024645,IGHA    c       (E)SEASPSIFPLSLGNEDP....AGQVVIGCLVQ GFFPS.APLS  VTWNQSGDNV....SVRNFPAVLAGS.......QYTMSSQLTLPASLC..PKDKSVTC QVQHL...SKASK TVDVPCKLE
Susscr AB699687,IGHA            (V)SETSPKIFPLTLGSSEP....AGYVVIACLVR DFFPS.EPLT  VTWSPSREGV....IVRNFPPAQAGG.......LYTMSSQLTLPVEQC..PADQILKC QVQHL...SKSSQ SVNVPCK
Trivul AF027382,IGHA    c       (N)PKVSPRLFPLSSFYSET....SDSIVLGCLAY RFFP..EPVD  MTWDYSGSGG....TVRNYPAMLIGD.......AYTQASVLDLPADQC..SNTQAYEC QVQHY....DTSA NLTVPCKA
Mondom AF012110,IGHA    c       (V)PKTSPTVFPMSLCDSRT....GDSVALGCLAQ GFFP..EPVT  LSWNYNGSEG....TVRSYPAMLSGN.......TYLQTSVLDLPANQC....PEAYKC GAKHY....DTSV DANVPCPV
Orycun X51647  ,IGHA1           (D)PATTPILFPLSLPCPLS....GQPVVVGCLIQ GFFPL.GPLN  VKWTISG.......ENVTFPPVQLDTS.....GLYTTSSLLNLTDEEC....PTCVAC HVEHN....EVDR YLILPCP
Orycun X82108  ,IGHA2          (D)LENSSPDLIPLPCPILEP....GEPMVIGCLIR GFFPR.GPLT  VTWNVSG.......ESVIFPPVPSPPS.....SLYTTYSLLRLPAEQC..PEENSVAC RVEHN....NKGQ DVTVPSPP
Orycun X82109  ,IGHA3           (A)TAAPPSLFPLIHPRCALKDT.PATVIAGCLIR GFFPL.GPLS  VSWNASG.......KNVTFPPVPSGTS.....GPYTTCSLLSLTPEQC..PEDHNVVC HVEHN...YDEGQ NLTVLYP
Orycun X82110  ,IGHA4           (V)PATPPIIFPLTCPGCVLKDT.SATIVAGCLIR GFFPR.GPLG  VTWNDNR.......ANLTFPPVQSATS.....SLYTTCSVLSLPAEQC..PAGNSVAC RVEHN....NKRQ DLTVPCL
Orycun X82111  ,IGHA5           (A)TAASPRLFPLIHPRCALKDT.SATVIAGCLIR GFFPL.GPLS  VSWNASG.......KNVTFPPVPSGTS.....GPYTTCSLLSLTPEQC..PEDDNVVC HVEHN...YDKGQ NLTVLYP
Orycun X82112  ,IGHA6          (D)PVNTRPILIPLPSPILGP....GEPVVIGCLIR GFFPL.GPLS  VTWNTSG.......ENLTFPPVQSATS.....SLYTTCSLLRLLAEQC..PEENSVAC HVEHN...YDKGQ HVTVPSPP
Orycun X82113  ,IGHA7           (E)PAATPDIFPLNLPLRVSDGN.SQTVVVGCLIR GFFPP.SPLR  VSWNVSRENM....SVYNFPPAPTGTS.....GPYTACSELILPVTQC..LEYDSAAC HVEYN...SVINE SLPVPFP
Orycun X82114  ,IGHA8           (A)SATTPGIYPLSLPLHVSDGN.SQPVVVGCLID GFFPP.GPLR  VSWNVSRENIT...SVYNFPPAPTGTS.....GPYTACSELILPDTQC..LRHQSAAC HVEYN....SVNQ SLLVPYP
Orycun X82115  ,IGHA9           (D)PATTPSLFPLSLPCPEC....AHPVVVGCLIR GFFPL.GPLN  VSWNGSE.......GGVIFPPVPSPSS.....SLYTTSSLLSLTDDQC..PRDGNVTC HVEHN...YDEGQ DLTVPCQ
Orycun X82116  ,IGHA10          (E)AATNLELFPMTCPRPRP....EQTVVVGCLIR GFPL..DPLS  VSWDVSGENV....RVYNFPPAQSGTS.....GLNTACSLLSLPSDQC..PADDNVTC HVVHN....NEGQ DLPVPCHP
Orycun X82117  ,IGHA11          (E)PATTPGIYPLSLPLRVSDGN.SQTVVVGCLIR GFFPL.GPLR  VSWNVSRENV....SIYNFPPAPTGTS.....GPYTACSELILPDTQC..LEYDSAAC HVEYN...SVINE SLPVPFP
Orycun X82118  ,IGHA12          (A)SATTPSLFPLILPGPVS....GETVVVGCLIR GFFPL.GPLN  VSWNGSE.......GDVIFPPVPSPPS.....SLYTTSSLLNLTIEEC....PKCVIC HVEHN....EVHR DLILPCP
Orycun X82119  ,IGHA13                                N.SQYVVVGCLIR GFFPP.GPLS  VSWTVNGENV....SAYNFPPAQSGTS.....GPYTACSELILPVTQC..LGQKSAAC HVEYN...SVINE SLPVPFP
Orycun AF314407,IGHA14                                                                                                   ILPPEEC..PAGNCVAC HVEHN...DDEGQ DLTVPCPP
Homsap K02875  ,IGHD            (A)PTKAPDVFPIISGCRHPKD..NSPVVLACLIT GYHP..TSVT  VTWYMGTQSQ....PQRTFPEIQRRD......SYYMTSSQLSTPLQQW...RQGEYKC VVQHT...ASKSK KEIFRWP
Musmus V00786  ,IGHD      (4)   (G)DKKEPDMFLLSECKAPEE...NEKINLGCLVI GSQ....PLK  ISWEPKKSSI....VEHVFPSEMRNG.......NYTMVLQVTVLASE....LNLNHTC TINKP...KRKEK PFKFP
Musmus AB699686,IGHD            (E)RQSAPSLFPLVSCVSPPSD..ESLVALGCLAR DFLP..SSVT  FSWNYKNSSKVSSQNIQDFPSVLRGG.......KYLASSRVLLPSVSIPQDPEAFLVC EVQHP....SGTK SVSISGP
Homsap J00222  ,IGHE            (A)STQSPSVFPLTRCCKNIPSN.ATSVTLGCLAT GYFP..EPVM  VTCDTGSLNG....TTMTLPATTLTLS.....GHYATISLLTVSGAW....AKQMFTC RVAHTPSSTDWVD NKTFS
Pantro M15398  ,IGHE            (A)PTRSPSLFPLTRCCKNIPSN.ATSVTLGCLAM GYFP..EPVM  VTWDAGSLNG....TTMTLPATTLTPS.....GHYATISLLTVSGAW....AKQMFTC RVAHTPSSTDWVD NKTFS
Canfam L36872  ,IGHE            (A)TSQDLSVFPLASCCKDNIA..STSVTLGCLVT GYLP..MSTT  VTWDTGSLNK....NVTTFPTTFHETY.....GLHSIVSQVTASGKW....AKQRFTC SVAHA...ESTAI NKTFS
Equcab AJ305046,IGHE            (V)SKQAPLILPLAACCKDTK...TTNITLGCLVK GYFP..EPVT  VTWDAGSLNR....STMTFPAVFDQTS.....GLYTTISRVVASGKW....AKQKFTC NVVHS....QETF NKTFN
Musmus X01857  ,IGHE            (A)SIRNPQLYPLKPCKG......TASMTLGCLVK DYFP..NPVT  VTWYSDSLNM....STVNFPALGSE........LKVTTSQVTSWGK.....SAKNFTC HVTHP...PSFNE SRTIL
Ratnor K02901  ,IGHE            (V)SVKAPSLYPLKPCSSEN....TASVTLGCLVK DYFP..DPVT  VTWYSDSLNT....STMNFPSVGSD........LKTTTSQMTSWGK.....SAKNFTC HVTHAP..STFVS DLTIR
Bostau U63640  ,IGHE            (A)SIQAPSIYPLRLCCTE.....EARVRLGCLVK DYLP..GSVT  VTWDTVPLDG....STLTFPSIQMASS.....SLYITTSQLTISGE.....QSKEFTC RVLHP...ETIQL NKTST
Oviari M84356  ,IGHE    c       (V)SSQHPSIYPLRTCCIK.....ETSVALGCLVK DYFP..GSVA  VTWDTAPLDG....STLTFPSIQMANS.....SLYVTTSQLTVSGE.....QPKQFTC SVFHAE..TNTTA MKTVST
Susscr AB699687,IGHE            (A)SIQGPLVYPLTSCCKTG....ATSKTLGCLVR GYFP..EPVT  VTWDTGSLNS....STLTFPAVQDSSS.....SLYTVTSQVTILGEW....TNQKLTC SVAHA....ANTT IRTIT
Trivul AF157617,IGHE    c         .TSTAPSVFPLVSGCDPNF...ESLSFLGCLVS GYFP..EPVT  VSWNPEVLDG....IITTFPAAYDSTS.....GLYTTTSQLAISDG.....SSQEFTC SVDHLP..TSTKI EKHVST
Mondom AF035194,IGHE    c       (E)PLTAPSVFPLMSCCDSNS...GGKAFLGCLAT GYFP..ESVT  INWNSEVLDE....IITNFPATYDPTS.....GRYTTTSQLTVSDL.....SDQEFTC SVDHLP..TSTKI KKTLSL
Homsap J00228  ,IGHG1           (A)STKGPSVFPLAPSSKSTS...GGTAALGCLVK DYFP..EPVT  VSWNSGALTS....GVHTFPAVLQSS......GLYSLSSVVTVPSSSL...GTQTYIC NVNHKP..SNTKV DKKV
Homsap J00230  ,IGHG2           (A)STKGPSVFPLAPCSRSTS...ESTAALGCLVK DYFP..EPVT  VSWNSGALTS....GVHTFPAVLQSS......GLYSLSSVVTVPSSNF...GTQTYTC NVDHKP..SNTKV DKTV
Homsap X03604  ,IGHG3           (A)STKGPSVFPLAPCSRSTS...GGTAALGCLVK DYFP..EPVT  VSWNSGALTS....GVHTFPAVLQSS......GLYSLSSVVTVPSSSL...GTQTYTC NVNHKP..SNTKV DKRV
Homsap K01316  ,IGHG4           (A)STKGPSVFPLAPCSRSTS...ESTAALGCLVK DYFP..EPVT  VSWNSGALTS....GVHTFPAVLQSS......GLYSLSSVVTVPSSSL...GTKTYTC NVDHKP..SNTKV DKRV
Macfas AF045536,IGHG1   c       (A)STKGPSVFPLAPSSRSTS...ESTAALGCLVK DYFP..EPVT  VSWNSGSLTS....GVHTFPAVLQSS......GLYSLSSVVTVPSSSL...GTQTYVC NVNHKP..SNTKV DKRV    
Macmul AF045537,IGHG1   c       (A)STKGPSVFPLAPSSRSTS...ESTAALGCLVK DYFP..EPVT  VSWNSGSLTS....GVHTFPAVLQSS......GLYSLSSVVTVPSSSL...GTQTYVC NVNHKP..SNTKV DKRV
Macmul AF045539,IGHG2   c       (A)STKGPSVFPLASCSRSTS...QSTGALGCLVK DYFP..EPVT  VSWNSGALTS....GVHTFQAVLQSS......GLYSLSSVVTVPSSSL...GTQTYVC NVVHEP..SNTKV DKTV
Macmul AF045538,IGHG3   c (m)   (A)STKGPS?FPLASCSRSTS...QSTAALGCLVK DYFP..EPVT  VSWNSGALTS....GVHTFPAVLQSS......GLYSLSSVVTVPSSSL...GTQTYVC NVVHEP..SNTKV DKRV
Pantro X65284  ,IGHG    c       (A)STKGPSVFPLAPSSKSTS...GGTQALGCLVK DYFP..EPVT  VSWNSGALTS....GVHTFPAVLQSS......GLYSLSSVVTVPSSSL...GTQTYIC NVDHKP..SNTKV DKKV
Canfam AF354264,IGHG1   c       (A)STTAPSVFPLAPSCGSTS...GSTVALACLVS GYFP..EPVT  VSWNSGSLTS....GVHTFPSVLQSS......GLHSLSSMVTVPSSRW...PSETFTC NVVHPA..SNTKV DKPV
Canfam AF354265,IGHG2   c       (A)STTAPSVFPLAPSCGSTS...GSTVALACLVS GYFP..EPVT  VSWNSGSLTS....GVHTFPSVLQSS......GLYSLSSMVTVPSSRW...PSETFTC NVAHPA..SKTKV DKPV
Canfam AF354266,IGHG3   c       (A)STTAPSVFPLAPSCGSQS...GSTVALACLVS GYIP..EPVT  VSWNSVSLTS....GVHTFPSVLQSS......GLYSLSSMVTVPSSRW...PSETFTC NVAHPA..TNTKV DKPV
Canfam AF354267,IGHG4   c       (A)STTAPSVFPLAPSCGSTS...GSTVALACLVS GYFP..EPVT  VSWNSGSLTS....GVHTFPSVLQSS......GLYSLSSTVTVPSSRW...PSETFTC NVVHPA..SNTKV DKPV
Equcab AJ302055,IGHG1           (A)STTAPKVFALAPGCGTTS...DSTVALGCLVS GYFP..EPVK  VSWNSGSLTS....GVHTFPSVLQSS......GFYSLSSMVTVPASSW...TSETYIC NVVHAA..SNFKV DKRI
Equcab AJ302056,IGHG2           (A)STTAPKYFQLTPSCGITS...DATVALGCLVS DYYP..EPVT  VSWNSGALTS....GVHTFPSVLQSS......GLYALSSMVTVPASTW...TSETYIC NVAHPA..SSTKV DKRI
Equcab AJ312379,IGHG3           (A)STTAPKVFPLAPSCGTTS...DSTVALGCLVS SYFP..EPVT  VSWNSGTLTS....GVRTFPSVLQSS......GLYSLSSMVTVPASSL...ESKTYIC NVAHPA..SSTKV DKRI
Equcab AJ302058,IGHG4           (A)STTAPKVFPLASHSAATS...GSTVALGCLVS SYFP..EPVT  VSWNSGALTS....GVHTFPSVLQSS......GLYSLSSMVTVPASSL...KSQTYIC NVAHPA..SSTKV DKKI
Equcab AJ312380,IGHG5           (E)SPKAPDVFPLTICGNTP....DPTVPVGCLVS NYFP..EPVT  VSWNCDALKG....DIHTFPLDLSNS......AHHSLSSMVAVPRSS....LNQTYIC SVAHPA..SSTKV DKRI
Equcab AJ312381,IGHG6           (A)STTAPKVFQLASHSAGTS...DSTVALGCLVS SYFP..EPVT  VSWNSGALTS....GVHTFPSVRQSS......GLYSLSSMVTVPASSL...KSQTYIC NVAHPA..SSTKV DKRI
Musmus J00453  ,IGHG1           (A)KTTPPSVYPLAPGSAAQT...NSMVTLGCLVK GYFP..EPVT  VTWNSGSLSS....GVHTFPAVLESD.......LYTLSSSVTVPSSPR...PSETVTC NVAHPA..SSTKV DKKI
Musmus V00825  ,IGHG2A          (A)KTTAPSVYPLAPVCGDTT...GSSVTLGCLVK GYFP..EPVT  LTWNSGSLSS....GVHTFPAVLQSD.......LYTLSSSVTVTSSTW...PSQSITC NVAHPA..SSTKV DKKI
Musmus V00763  ,IGHG2B          (A)KTTPPSVYPLAPGCGDTT...GSSVTSGCLVK GYFP..EPVT  VTWNSGSLSS....SVHTFPALLQSG.......LYTMSSSVTVPSSTW...PSQTVTC SVAHPA..SSTTV DKKL
Musmus J00479  ,IGHG2C          (A)KTTAPSVYPLAPVCGGTT...GSSVTLGCLVK GYFP..EPVT  LTWNSGSLSS....GVHTFPALLQSG.......LYTLSSSVTVTSNTW...PSQTITC NVAHPA..SSTKV DKKI
Musmus X00915  ,IGHG3           (A)TTTAPSVYPLVPGCSDTS...GSSVTLGCLVK GYFP..EPVT  VKWNYGALSS....GVRTVSSVLQSG.......FYSLSSLVTVPSSTW...PSQTVIC NVAHPA..SKTEL IKRI
Ratnor M28670  ,IGHG1           (A)ETTAPSVYPLAPGTALKS...NSMVTLGCLVK GYFP..EPVT  VTWNSGALSS....GVHTFPAVLQSG.......LYTLTSSVTVPSSTW...PSQTVTC NVAHPA..SSTKV DKKI
Ratnor M28669  ,IGHG2A          (A)ETTAPSVYPLAPGTALKS...NSMVTLGCLVK GYFP..EPVT  VTWNSGALSS....GVHTFPAVLQSG.......LYTLTSSVTVPSSTW...SSQAVTC NVAHPA..SSTKV DKKI
Ratnor M28671  ,IGHG2B          (A)QTTAPSVYPLAPGCGDTT...SSTVTLGCLVK GYFP..EPVT  VTWNSGALSS....DVHTFPAVLQSG.......LYTLTSSVT..SSTW...PSQTVTC NVAHPA..SSTKV DKKV
Ratrat X07189  ,IGHG2C  c       (A)RTTAPSVYPLVPGCSGTS...GSLVTLGCLVK GYFP..EPVT  VKWNSGALSS....GVHTFPAVLQSG.......LYTLSSSVTVPSSTW...SSQTVTC SVAHPA..TKSNL IKRI
Bostau X16701  ,IGHG1           (A)STTAPKVYPLSSCCGDKS...SSTVTLGCLVS SYMP..EPVT  VTWNSGALKS....GVHTFPAVLQSS......GLYSLSSMVTVPGST....SGQTFTC NVAHPA..SSTKV DKAV
Bostau M36946  ,IGHG2           (A)STTAPKVYPLSSCCGDKS...SSTVTLGCLVS SYMP..EPVT  VTWNSGALKS....GVHTFPAVLQSS......GLYSLSSMVTVPGST....SGQTFTC NVAHPA..SSTKV DKAV
Bostau U63638  ,IGHG3     (2)   (A)STTAPKVYPLASSCGDTS...SSTVTLGCLVS SYMP..EPVT  VTWNSGALKS....GVHTFPAVRQSS......GLYSLSSMVTVPASSS...ETQTFTC NVAHPA..SSTKV DKAVTARRPVPTTPKTTIPPGKPTTP
Oviari X69797  ,IGHG1   c       (A)STTPPKVYPLTSCCGDTS...SSIVTLGCLVS SYMP..EPVT  VTWNSGALTS....GVHTFPAILQSS......GLYSLSSVVTVPASTS...GAQTFIC NVAHPA..SSTKV DKRV
Oviari X70983  ,IGHG2   c       (A)STTAPKVYPLTSCCGDTSSS.SSIVTLGCLVS SYMP..EPVT  VTWNSGALTS....GVHTFPAILQSS......GLYSLSSVVTVPASTS...GAQTFIC NVAHPA..SSAKV DKRV
Susscr AB699686,IGHG1           (A)PKTAPSVYPLAPCGRDTS...GPNVALGCLAS SYFP..EPVT  MTWNSGALTS....GVHTFPSVLQPS......GLYSLSSMVTVPASSL...SSKSYTC NVNHPA..TTTKV DKRV
Susscr U03779  ,IGHG2   c       (A)PKTAPSVYPLAPCSRDTS...GPNVALGCLAS SYFP..EPVT  VTWNSGALSS....GVHTFPSVLQPS......GLYSLSSMVTVPASSL...SSKSYTC NVNHPA..TTTKV DKRV
Susscr AB699686,IGHG3           (A)YNTAPSVYPLAPCGRDVS...DHNVALGCLVS SYFP..EPVT  VTWNSGALSR....VVHTFPSVLQPS......GLYSLSSMVIVAASSL...STLSYTC NVYHPA..TNTKV DKRV
Susscr EU372654,IGHG4           (A)PKTAPSVYPLAPCGRDVS...GPNVALGCLAS SYFP..EPVT  VTWNSGALTS....GVHTFPSVLQPS......GLYSLSSMVTVPASSL...SSKSYTC NVNHPA..TTTKV DKRV
Susscr AB699686,IGHG5-1         (A)PKTAPSVYPLAPCGRDVS...DHNVALGCLAS SYFP..EPVT  VTWNWGAQTS....GVHTFPSVLQPS......GLYSLSSTVTVPAHSL...SSKCFTC NVNHPA..TTTKV DLCV
Susscr AB699686,IGHG5-2         (A)PKTAPSVYPLAPCSRDTS...GPNVALGCLVS SYFP..ELVT  VTWNSGALTS....GVHTFPSVLQPS......GLYSLSSMVTVPAHSL...SSKRYTC NVNHPA..TKTKV DLCV
Susscr AB699687,IGHG6-1         (A)PKTAPSVYPLAPCGRDTS...GPNVALGCLAS SYFP..EPVT  VTWNSGALTS....GVHTFPSVLQPS......GLYSLSSMVTVPASSL...SSKSYTC NVNHPA..TTTKV DKRV
Susscr AB699687,IGHG6-2         (A)PKTAPSVYPLAPCGRDTS...GPNVALGCLAS SYFP..EPVT  VTWNSGALTS....GVHTFPSVLQPS......GLYSLSSMVTVPARSS...SRKCFTC NVNHPA..TTTKV DLCV
Trivul AF157619,IGHG    c       (A)SPTAPSVFALAPNCGQGT...SSQVAMACLVS NYFP..EPVT  VTWNSGAISS....GIQTYPSILQSS......GLYTSSSQLTVPADDW...LTKSYIC NVAHKP..TSTKT DKKI
Mondom AF035195,IGHG    c       (A)RPTAPSVFPLVSSCGQET...QAQMALGCLVT SYFP..EPVT  VTWNSGTTTS....GIQTYPSVLQPS......GLYTLTSQLTIPADSW...SSQSYTC NVAHPA..TSTKI DKKI
Camdro AJ131945,IGHG2     (1)   (A)STKAPSVYPLTARSGDTP...GSTVAFGCLVW GYIP..EPVT  VTWNSGAVSS....GIHTFPSVLMSL......GLYSLSSLVTLPTSTS...TGKTFIS NVAHPA..SSTKV DKSV
Orycun L29172  ,IGHG            (G)QPKAPSVFPLAPCCGDTP...SSTVTLGCLVK GYLP..EPVT  VTWNSGTLTN....GVRTFPSVRQSS......GLYSLSSVVSVTSS......SQPVTC NVAHPA..TNTKV DKTV
Homsap X57331  ,IGHM            (G)SASAPTLFPLVSCENSPSD..TSSVAVGCLAQ DFLP..DSIT  LSWKYKNNSDIS..STRGFPSVLRGG.......KYAATSQVLLPSKDVMQGTDEHVVC KVQHP....NGNK EKNVPLP
Macmul AF046784,IGHM    c (m)   (G)SASAPTLFPLVSCENAPLD..TNEVAVGCLAQ DFLP..DSIT  FSWKFKNNSNISK.GVWGFPSVLRGG.......KYAATSQVLLASKDVMQGTDEHVVC KVQHP....NGNK EQNVPLP
Equcab L49414  ,IGHM    c       (E)STKTPDLFPLVSCGPSLD...ESLVAVGCLAR DFLP..NVIT  FSLELPEQHCSQYPGHHEFPSVLREG.......KYSASSQVLLPSG......DVPLVC TVNHS....NGNE KVEVRPQ
Musmus V00818  ,IGHM            (E)SQSFPNVFPLVSCESPLSD..KNLVAMGCLAR DFLP..STIS  FTWNYQNNTEVIQ.GIRTFPTLRTGG.......KYLATSQVLLSPKSILEGSDEYLVC KIHYG....GKNR DLHVPIP
Ratnor X68782  ,IGHM    c       (E)SQSSPTVLPLVSCESPLSD..ENLVAMGCLAR DFLP..SSIS  FSWNYQNNTEVMQ.GVRTFPTLRTGD.......KYTATSQVLLSAKNVLEGSDEYLVC KIHHG....NKNK DLHVPIP
Bostau U63637  ,IGHM            (E)GESHPKVFPLVSCVSSPSD..ESTVALGCLAR DFVP..NSVS  FSWKFNNSTVSSE.RFWTFPEVLRDG.......LWSASSQVVLPSSSAFQGPDDYLVC EVQHPK.GGKTVG TVRVIAT
Oviari L04260  ,IGHM    c (m)   (E)SESHPKVFPLVSCVSSPSD..ENTVALGCLAR DFVP..NSVS  FSWKFNNSTVSSE.RFWTFPEVLRDG.......LWSASSQVALHSSSTFQGTDGYLVC EVQHPK.GGKTVG TVMVVAP
Susscr AB699686,IGHM            (E)SQSAPNLFPLVSCVSPPSD..ESLVALGCLAR DFLP..SSVT  FSWNYKNSSKVSSQNIQDFPSVLRGG.......KYLASSRVLLPSVSIPQDPEAFLVC EVQHP....SGTK SVSISGP
Trivul AF157618,IGHM    c       (A)TQAAPNLFSLSSCWSSQMK..DAPVAVGCLAK DFLP..DSID  FSWSYQNRSAVSNTDLKIFPSLMRGS.......TYTATSQVILHANDAFQGEDSYLVC KTRHP....RGDK EVQVPLR
Mondom AF012109,IGHM    c       (A)LPSAPNLFSLSPCLNSGVE..DAPVAVGCLAK DFLP..DSIN  FSWTYQNQSAVSHTDLKIFPSQMSGP.......TYTATSQVILPALDV..LQDSYLVC KASHL....NSNK QVQVSLP
Orycun J00666  ,IGHM    c       (V)SLSSPTLYPLVSCEGALTD..GNLVAMGCLAR DFLP..SSVT  FSWSFKNNSEISSRTVRTFPVVKRGD.......KYMATSQVLVPSKDVLQGTEEYLVC KVQHS....NSNR DLRVSFP
       CH2
Homsap J00220  ,IGHA1               CCHPRLSLHRPALEDLLL..GSEANLTCTLT GLRDA.SGVT  FTWTPSSGKS....AVQGPPERDLCG.......CYSVSSVLPGCAEPW..NHGKTFTC TAAYPE..SKTPL TATLSKS
Homsap J00221  ,IGHA2               CCHPRLSLHRPALEDLLL..GSEANLTCTLT GLRDA.SGAT  FTWTPSSGKS....AVQGPPERDLCG.......CYSVSSVLPGCAQPW..NHGETFTC TAAHPE..LKTPL TANITKS
Macfas X53705  ,IGHA                CDKPRLSLRRPALEDLLL..GSEANLTCTLT GLRNP.SGAT  FTWTPSSGKN....AVQQSPKRDPCG.......CYSVSSVLPGCAEPW..NNRVTFTC TAEHPE..LETQL TATISKP
Macmul AY039245,IGHA                CDKPRLSLRRPALEDLLL..GSEANLTCTLT GLRDP.SGAT  FTWTPSSGKN....AVQQSPEHDPCG.......CYSVSSVLPGCAEPW..NNRVTFTC TAEHPE..LETQL TATISKS
Pantro X53702  ,IGHA1	            CCHPRLLLHRPALEDLLL..GSEANLTCTLT GLRDA.SGAT  FTWSPSSGKS....AVQGPPERDLCG.......CYSVSSVLPGCAEPW..NHGETFTC TAAYPE..SKTPL TANITKS
Pantro X53706  ,IGHA2               CCHPRLSLHRPALEDLLL..GSEANLTCTLT GLRDA.SGAT  FTWTPPSGKS....AVQGPPERDLCG.......CYSVSSVLPGCAQPW..NHGETFTC TAAHPE..LKNPL TANITKS
Canfam L36871  ,IGHA                CNEPRLSLQKPALEDLLL..GSNASLTCTLS GLKDP.KGAT  FTWNPSKGKE....PIQKNPERDSCG.......CYSVSSVLPGCADPW..NHGDTFSC TATHPE..SKSPI TVSITKTT
Musmus J00475  ,IGHA                SCQPSLSLQRPALEDLLL..GSDASITCTLN GLRNP.EGAA  FTWEPSTGKD....AVQKKAAQNSCG.......CYSVSSVLPGCAERW..NSGASFKC TVTHPE..SGTLT GTIAKVT
Bostau AF109167,IGHA                NCEPSLSVQPPALEDLLL..GSNASLTCTLS GLKSA.EGAS  FTWNPTGGKT....AVQGSPKRDSCG.......CYSVSSVLPGCADPW..NSGQTFSC SVTHPE..SKSSL TATIKKDL
Oviari AF024645,IGHA    c           NCEPSLSLQPPALEDLLL..SSNASLTCTLR GLKSA.KGAS  FTWSPTGGKT....AVQGLPERDSCG.......CYSVSSVLPGCADPW..NSGQTFSC SATYP....DGSL TTTIKKDL
Susscr AB699687,IGHA                CCKPSLSLQPPALADLLL..GSNASLTCTLS GLKKS.EGVS  FTWQPSGGKD....AVQASPTRDSCG.......CYSVSSILPGCADPW..NKGETFSC TAAHSE..LKSAL TATITKPK
Trivul AF027382,IGHA               CSKTAYVSLSPPSLESLLL..GTGANLTCTLS GLKSS.TGVE  FTWARTPAPASTLSPIQGTAEQDSSG.......KYSVSSVLEICTEEW..IRGDVFSC TVSHP...EIETT TKTIYKPK
Mondom AF012110,IGHA    c            SGVHVSLSGPSLESLLL..GIGANLTCTLS GIKNS.NGAT  FTWVHDTAQASTLRPIQGAPEQDSNG.......KYRVSSVLEICTEEW..LRGDTFSC TVSHS...EIETT TKTIYKPK
Orycun X51647  ,IGHA1               CGEPSLSLQRPDLRDLLL..GSDASLTCTLR GLKDP.KDAV  FTWEPTNGNE....PVQQSPQRDPCG.......CYSVSSVLPGCAETW..TAGTEFTC TVTHPE.IEGSSL TATIRKDT
Orycun X82108  ,IGHA2               CGKPSLSLQRPDLGDLLL..NSNASLTCTLR GLLNP.EGAV  FTWEPTFGKE....PVQQSPQLDHCG.......CYSVSSVLPGCAVLW..NAGTEFTC TVTHPE.IEGDSL TGTISKDT
Orycun X82109  ,IGHA3               CGEPSLSLQRPDIGDLLL..ESNASLTCTLS GLKDP.EGAV  FTWNPTNGNE....PVQQSTQSYPCG.......CYSVSSVLPGCAEPW..NAGTEFTC TVTHPE.IEGGSL TATISR
Orycun X82110  ,IGHA4               CGKPSLSLQRPDLGDLLL..DSNASLTCTLR GLLNP.EGAV  FTWNPTNGKE....PVQQSAQRDHCG.......CYSVSSVLPGCAEPW..NAGTVFTC TVTHPE.IDSGSL TATISKDT
Orycun X82111  ,IGHA5               CGEPSLSLQRPDLGDLLL..NSNASLTCTLR GLLDP.EGAV  FTWEPTFGKE....PVQLSPRLDHCG.......CYSVSSVLPGCAAAW..NAGTKFNC TVTHPE.IKGVSL TDIISKDT
Orycun X82112  ,IGHA6               CGEPSLSLQRPFLRDLLL..NSNASLTCTLR GLKNP.EGAV  FTWEPTNGNK....PVQQSVQSYPCG.......CYSVSSVLPGCAEPW..NAGTEFTC TVTHPE.IEGGPL TAKISKDT
Orycun X82113  ,IGHA7               CEEPSLSLQRPDLRDLLL..GSDASLTCTLR GLKYP.EDAV  FTWEPTNGNE....PVQQSPQRDPCG.......CYSVSSVLPGCAEPW..NAGTEFTC TVTHPE.IEGGSL TATISKDT
Orycun X82114  ,IGHA8                CQPSLSLQRPDIGDLLL..GRDASLTCTLS GLKDP.EGAV  FTWEPTNGNE....PVQQRAQRDLSG.......CYSVSSVLPSSAETW..KVRTEFTC TVTHPE.IEGGSL TATISKDT
Orycun X82115  ,IGHA9               CGEPSLSLQRPDIGDLLL..ESKASLTCTLS GLKDP.EGAV  FTWEPTNGNE....PVQQSVQSYPCG.......CYSVSSVLPGCAEPW..NAGTEFTC TVTHPE.IEGGSL TATISISR
Orycun X82116  ,IGHA10              CGEPSLSLQRPDIGDLLL..ESKASLTCTLS GLKDP.EGAV  FTWEPTNGNE....PVQQSTQSYPCG.......CYSVSSVLPGCAEPW..NAGTEFTC TVTHPE.IEGGSL TATISR
Orycun X82117  ,IGHA11              CEEPSLSLQRPDLRDLLL..GSDASLTCTLR GLKDP.EGAV  FTWEPTNGNE....PVQQSPQRDPCG.......CYSVSSVLPGCAEPW..NAGTEFTC TVTHPE.IEGSSL TATISKDT
Orycun X82118  ,IGHA12              CGEPSLSLQRPDIGDLLL..ESKASLTCTLS GLKDP.EGAV  FTWEPTNGNE....PVQQSVQSYPCG.......CYSVSSVLPGCAEPW..NAGTEFTC TVTHPE.IEGGSL TAKISR
Orycun X82119  ,IGHA13               CQPSLSLQRPDLGDLLL..GRDASLTCTLS GLKNP.EDAV  FTWEPTNGNE....PVQQRAQRDLSG.......CYSVSSVLPSSAETW..KARTEFTC TVTHPE.IDSGSL TATISR
Orycun AF314407,IGHA14               CQPSLSLQRPDLGDL
Homsap K02878  ,IGHD         (E)CPSHTQPLGVYLLTPAVQDLWL..RDKATFTCFVV GSDL..KDAH  LTWEVAGKVPTG..GVEEGLLERHSN......GSQSQHSRLTLPRSLW..NAGTSVTC TLNHPS..LPPQR LMALREP
Susscr AB699686,IGHD         (A)CQNHTRPPSVYLLLPPLQGLWL..RAEATFTCLAV GQDL..QEAR  LSWAVAEEPQGG..RMEEGPTEHTNG.......SWSLSSRLALPRSSW..AAGAPVTC RLSGP....GLRS LVTAEARREH
Homsap J00222  ,IGHE         (V)CSRDFTPPTVKILQSSCDGGGHF.PPTIQLLCLVS GYTP..GTIN  ITWLEDGQVMD...VDLSTASTTQEG......ELASTQSELTLSQKHW..LSDRTYTC QVTYQ....GHTF EDSTKKCA
Pantro M15398  ,IGHE	      (V)CSRDFTPTVKVLQSSCDGGGHF.PPTIQLLCLVS GYTP..GTIN  ITWLEDGQVMD...VDLSTASATQEG......ELASTQSELTLSQKHW..LSDRTYTC QVTYQ....GGTF EDSTKKCA
Canfam L36872  ,IGHE         (A)CALNFIPPTVKLFHSSCNPVGDT.HTTIQLLCLIS GYVP..GDME  VIWLVDGQKATN..IFPYTAPGTKEG......NVTSTHSELNITQGEW..VSQKTYTC QVTYQ....GFTF KDEARKCS
Equcab AJ305046,IGHE         (A)CIVTFTPPTVKLFHSSCDPGGDS.HTTIQLLCLIS DYTP..GDID  IVWLIDGQKVDE..QFPQHGLVKQEG......KLASTHSELNITQGQW..ASENTYTC QVTYK....DMIF KDQARKCT
Musmus X01857  ,IGHE         (V)RPVNITEPTLELLHSSCDPNAF..HSTIQLYCFIY GHIL..NDVS  VSWLMDDREITD..TLAQTVLIKEEG......KLASTCSKLNITEQQW..MSESTFTC KVTSQ....GVDY LAHTRRCP
Ratnor K02901  ,IGHE         (A)RPVNITKPTVDLLHSSCDPNAF..HSTIQLYCFVY GHIQ..NDVS  IHWLMDDRKIYE..THAQNVLIKEEG......KLASTYSRLNITQQQW..MSESTFTC KVTSQ....GENY WAHTRRCS
Bostau U63640  ,IGHE         (E)CVKNFSDPSVKLFFSSCNPNGDT.QTTIHLLCRIS AYTP..GKIK  VTWLVDGLQSEE..LYARSGPEIQEG......NLTSTYSEVNITQGQW..VSEKTYTC RVNYY....GYNF ESHAHRCT
Oviari M84356  ,IGHE    c    (E)CAKNFSDPSVRLFYSSCDPSGDT.HTTIQLLCRIS GYTP..GKIK  VTWLVDGHESKE..LYAQPGPEIQEG......NLTTTYSEVNITQGQW..ASEKTYTC RVNYY....GFNF DNHARRCTA
Susscr AB699687,IGHE         (G)CTKNFTDPSLRFFYSSCDPHGDA.QATIHLRCYIS GYTP..GKMK  VTWLVDGQEDRN..LFSYTAPDQLEG......KLASTYSEVNITQGQW..ASQITYTC QVSYY....GFIY EKHALRCT
Trivul AF157617,IGHE    c  (G)PTKNGPVIPPTVKLFHSSCDPRGDA.HSTIQLLCLVS GFSP..ARVK  VTWLVDGQEAEN..LFPYTTRPKREGS.....QTFSLQSELNITQGQW..TSLKTYTC QVTHN....GSIY RDNAQKCS
Mondom AF035194,IGHE    c  (P)ECGPVTIIPPTVKLFHSSCDPRGDA.HSTIQLLCLVS GFSP..AKVH  VTWLVDGQEAEN..LFPYTTRPKREGG.....QTFSLQSEVNITQGQW..MSSNTYTC HVKHN....GSIF EDSAQKCS
Homsap J00228  ,IGHG1         (A)PELLGGPSVFLFPPKPKDTLMI.SRTPEVTCVVV DVSHEDPEVK  FNWYVDGVEVH...NAKTKPREEQYN......STYRVVSVLTVLHQDW..LNGKEYKC KVSNKA..LPAPI EKTISKAK
Homsap J00230  ,IGHG2         (A)P.PVAGPSVFLFPPKPKDTLMI.SRTPEVTCVVV DVSHEDPEVQ  FNWYVDGVEVH...NAKTKPREEQFN......STFRVVSVLTVVHQDW..LNGKEYKC KVSNKG..LPAPI EKTISKTK
Homsap X03604  ,IGHG3         (A)PELLGGPSVFLFPPKPKDTLMI.SRTPEVTCVVV DVSHEDPEVQ  FKWYVDGVEVH...NAKTKPREEQYN......STFRVVSVLTVLHQDW..LNGKEYKC KVSNKA..LPAPI EKTISKTK
Homsap K01316  ,IGHG4         (A)PEFLGGPSVFLFPPKPKDTLMI.SRTPEVTCVVV DVSQEDPEVQ  FNWYVDGVEVH...NAKTKPREEQFN......STYRVVSVLTVLHQDW..LNGKEYKC KVSNKG..LPSSI EKTISKAK
Macfas AF045536,IGHG1   c     (A)PELLGGPSVFLFPPKPKDTLMI.SRTPEVTCVVV DVSQEDPDVK  FNWYVNGAEVH...HAQTKPRETQYN......STYRVVSVLTVTHQDW..LNGKEYTC KVSNKA..LPAPI QKTISKDK   
Macmul AF045537,IGHG1   c     (S)PELLGGPSVFLFPPKPKDTLMI.SRTPEVTCVVV DVSQEDPDVK  FNWYVNGAEVH...HAQTKPRETQYN......STYRVVSVLTVTHQDW..LNGKEYTC KVSNKA..LPAPI QKTISKDK
Macmul AF045539,IGHG2   c     (P)AELLGGPSVFLFPPKPKDTLMI.SRTPEVTCVVV DVSQEEPDVK  FNWYVDGVEVH...NAQTKPREEQFN......STYRVVSVLTVTHQDW..LNGKEYTC KVSNKA..LPAPK QKTVSKTK
Macmul AF045538,IGHG3   c (m) (A)PELLGGPSVFLFPPKPKDTLMI.SRTPEVTCVVV DVSQEDPEVQ  FNWYVDGAEVH...HAQTKPREEQFN......STYRVVSVLTVTHQDW..LNGKEYTC KVSNKG..LPAPI EKTISKAK
Pantro X61311  ,IGHG    c     (A)PELLGGPSVFLFPPKPKDTLMI.SRTPEVTCVVV DVSHEDPEVK  FNWYVDGVEVH...NAKTKPREEQYN......STYRVVSVLTVLHQDW..LNGKEYKC KVSNKA..LPAPI EKTISKAK
Canfam AF354264,IGHG1   c     (V)PEPLGGPSVLIFPPKPKDILRI.TRTPEVTCVVL DLGREDPEVQ  ISWFVDGKEVH...TAKTQSREQQFN......GTYRVVSVLPIEHQDW..LTGKEFKC RVNHID..LPSPI ERTISKAR
Canfam AF354265,IGHG2   c     (A)PEMLGGPSVFIFPPKPKDTLLI.ARTPEVTCVVV DLDPEDPEVQ  ISWFVDGKQMQ...TAKTQPREEQFN......GTYRVVSVLPIGHQDW..LKGKQFTC KVNNKA..LPSPI ERTISKAR
Canfam AF354266,IGHG3   c     (G)CGLLGGPSVFIFPPKPKDILVT.ARTPTVTCVVV DLDPENPEVQ  ISWFVDSKQVQ...TANTQPREEQSN......GTYRVVSVLPIGHQDW..LSGKQFKC KVNNKA..LPSPI EEIISKTP
Canfam AF354267,IGHG4   c     (V)PESLGGPSVFIFPPKPKDILRI.TRTPEITCVVL DLGREDPEVQ  ISWFVDGKEVH...TAKTQPREQQFN......STYRVVSVLPIEHQDW..LTGKEFKC RVNHIG..LPSPI ERTISKAR
Equcab AJ302055,IGHG1         (A)PELLGGPSVFIFPPNPKDTLMI.TRTPEVTCVVV DVSQENPDVK  FNWYMDGVEVR...TATTRPKEEQFN......STYRVVSVLRIQHQDW..LSGKEFKC KVNNQA..LPQPI ERTITKTK
Equcab AJ302056,IGHG2     (3)      (G)GPSVFIFPPNPKDALMI.SRTPVVTCVVV NLSDQYPDVQ  FSWYVDNTEVH...SAITKQREAQFN......STYRVVSVLPIQHQDW..LSGKEFKC SVTNVG..VPQPI SRAISRGK
Equcab AJ312379,IGHG3         (A)PELLGGPSVFIFPPKPKDVLMI.TRTPEVTCLVV DVSHDSSDVL  FTWYVDGTEVK...TAKTMPNEEQNN......STYRVVSVLRIQHQDW..LNGKKFKC KVNNQA..LPAPV ERTISKAT
Equcab AJ302058,IGHG4          (E)CLSVGPSVFIFPPKPKDVLMI.SRTPTVTCVVV DVGHDFPDVQ  FNWYVDGVETH...TATTEPKQEQNN......STYRVVSILAIQHKDW..LSGKEFKC KVNNQA..LPAPV QKTISKPT
Equcab AJ312380,IGHG5         (A)PELPGGPSVFIFPPKPKDVLKI.SRKPEVTCVVV DLGHDDPDVQ  FTWFVDGVETH...TATTEPKEEQFN......STYRVVSVLPIQHQDW..LSGKEFKC SVTNKA..LPAPV ERTTSKAK
Equcab AJ312381,IGHG6         (D)SKFLGRPSVFIFPPNPKDTLMI.SRTPEVTCVVV DVSQENPDVK  FNWYVDGVEAH...TATTKAKEKQDN......STYRVVSVLPIQHQDW..RRGKEFKC KVNNRA..LPAPV ERTITKAK
Musmus J00453  ,IGHG1            (V)PEVSSVFIFPPKPKDVLTI.TLTPKVTCVVV DISKDDPEVQ  FSWFVDDVEVH...TAQTQPREEQFN......STFRSVSELPIMHQDW..LNGKEFKC RVNSAA..FPAPI EKTISKTK
Musmus V00825  ,IGHG2A        (A)PNLLGGPSVFIFPPKIKDVLMI.SLSPIVTCVVV DVSEDDPDVQ  ISWFVNNVEVH...TAQTQTHREDYN......STLRVVSALPIQHQDW..MSGKEFKC KVNNKD..LPAPI ERTISKPK
Musmus V00763  ,IGHG2B        (A)PNLEGGPSVFIFPPNIKDVLMI.SLTPKVTCVVV DVSEDDPDVQ  ISWFVNNVEVH...TAQTQTHREDYN......STIRVVSTLPIQHQDW..MSGKEFKC KVNNKD..LPSPI ERTISKIK
Musmus J00479  ,IGHG2C        (A)PDLLGGPSVFIFPPKIKDVLMI.SLSPMVTCVVV DVSEDDPDVQ  ISWFVNNVEVH...TAQTQTHREDYN......STLRVVSALPIQHQDW..MSGKEFKC KVNNRA..LPSPI EKTISKPR
Musmus X00915  ,IGHG3         (P)GNILGGPSVFIFPPKPKDALMI.SLTPKVTCVVV DVSEDDPDVH  VSWFVDNKEVH...TAWTQPREAQYN......STFRVVSALPIQHQDW..MRGKEFKC KVNNKA..LPAPI ERTISKPK
Ratnor M28670  ,IGHG1            (V)SEVSSVFIFPPKPKDVLTI.TLTPKVTCVVV DISQDDPEVH  FSWFVDDVEVH...TAQTRPPEEQFN......STFRSVSELPILHQDW..LNGRTFRC KVTSAA..FPSPI EKTISKPE
Ratnor M28669  ,IGHG2A           (G)SEVSSVFIFPPKTKDVLTI.TLTPKVTCVVV DISQNDPEVR  FSWFIDDVEVH...TAQTHAPEKQSN......STLRSVSELPIVHRDW..LNGKTFKC KVNSGA..FPAPI EKSISKPE
Ratnor M28671  ,IGHG2B        (V)PELLGGPSVFIFPPKPKDILLI.SQNAKVTCVVV DVSEEEPDVQ  FSWFVNNVEVH...TAQTQPREEQYN......STFRVVSALPIQHQDW..MSGKEFKC KVNNKA..LPSPI EKTISKPK
Ratrat X07189  ,IGHG2C  c      (D)DNLGRPSVFIFPPKPKDILMI.TLTPKVTCVVV DVSEEEPDVQ  FSWFVDNVRVF...TAQTQPHEEQLN......GTFRVVSTLHIQHQDW..MSGKEFKC KVNNKD..LPSPI EKTISKPR
Bostau X16701  ,IGHG1         (P)PELPGGPSVFIFPPKPKDTLTI.SGTPEVTCVVV DVGHDDPEVK  FSWFVDDVEVN...TATTKPREEQFN......STYRVVSALRIQHQDW..TGGKEFKC KVHNEG..LPAPI VRTISRTK
Bostau M36946  ,IGHG2           (C)CVREPSVFIFPPKPKDTLMI.TGTPEVTCVVV NVGHDNPEVQ  FSWFVDDVEVH...TARTKPREEQFN......STYRVVSALPIQHQDW..TGGKEFKC KVNIKG..LSASI VRIISRSK
Bostau U63638  ,IGHG3           (E)PLGGLSVFIFPPKPKDTLTI.SGTPEVTCVVV DVGQDDPEVQ  FSWFVDDVEVH...TARTKPREEQFN......STYRVVSALRIQHQDW..LQGKEFKC KVNNKG..LPAPI VRTISRTK
Oviari X69797  ,IGHG1   c      (P)ELPGGPSVFIFPPKPKDTLTI.SGTPEVTCVVV DVGQDDPEVQ  FSWFVDNVEVR...TARTKPREEQFN......STFRVVSALPIQHQDW..TGGKEFKC KVHNEA..LPAPI VRTISRTK
Oviari X70983  ,IGHG2   c         (V)SRPSVFIFPPKPKDSLMI.TGTPEVTCVVV DVQGD.PEVQ  FSWFVDNVEVR...TARTKPREEQFN......STFRVVSALPIQHDHW..TGGKEFKC KVHSKG..LPAPI VRTISRAK
Susscr AB699686,IGHG1          (G)CEVAGPSVFIFPPKPKDTLMI.SQTPEVTCVVV DVSKEHAEVQ  FSWYVDGVEVH...TAETRPKEEQFN......STYRVVSVLPIQHQDW..LKGKEFKC KVNNVD..LPAPI TRTISKAI
Susscr U03779  ,IGHG2   c     (A)ACESPGPSVFIFPPKPKDTLMI.SRTPQVTCVVV DVSQENPEVQ  FSWYVDGVEVH...TAQTRPKEEQFN......STYRVVSVLPIQHQDW..LNGKEFKC KVNNKD..LPAPI TRIISKAK
Susscr AB699686,IGHG3         (A)AEVLGAPSVFLFPPKPKDILMI.SRTPKVTCVVV DVSQEEAEVQ  FSWYVDGVQLY...TAQTRPMEEQFN......STYRVVSVLPIQHQDW..LKGKEFKC KVNNKD..LLSPI TRTISKAT
Susscr EU372654,IGHG4          (A)CEGPGPSAFIFPPKPKDTLMI.SRTPKVTCVVV DVSQENPEVQ  FSWYVDGVEVH...TAQTRPKEEQFN......STYRVVSVLLIQHQDW..LNGKEFKC KVNNKD..LPAPI TRIISKAK
Susscr AB699686,IGHG5-1           (V)AGPSVFIFPPKPKDILMI.SRTPEVTCVVV DVSKEHAEVQ  FSWYVDGEEVH...TAETRPKEEQFN......STYRVVSVLPIQHEDW..LKGKEFEC KVNNED..LPGPI TRIISKAK
Susscr AB699686,IGHG5-2        (G)CEVAGPSVFIFPPKPKDILMI.SRTPEVTCVVV DVSKEHAEVQ  FSWYVDGVEVH...TAETRPKEEQFN......STYRVVSVLPIQHEDW..LKGKEFEC KVNNED..LPGPI TRIISKAK
Susscr AB699687,IGHG6-1        (A)CEGPGPSAFIFPPKPKDTLMI.SRTPKVTCVVV DVSQENPEVQ  FSWYVDGVEVH...TAQTRPKEEQFN......STYRVVSVLPIQHQDW..LNGKEFKC KVNNKD..LPAPI TRIISKAK
Susscr AB699687,IGHG6-2        (A)CEGPGPSAFIFPPKPKDTLMI.SRTPQVTCVVV DVSQENPEVQ  FSWYVDGVEVH...TAQTRPKEAQFN......STYRVVSVLPIQHEDW..LKGKEFEC KVNNKD..LPAPI TRIISKAK
Trivul AF157619,IGHG           (A)CDVVGPSVFLFPPNPKDTLTL.SRVPKITCVVV DVSDA.SEVQ  ISWYKGENAI....DSPKPTERKLNN......GTFQVVSTLSVAHQEW..LNGVAYTC KVDNKE..LPYPE RKTIFHTK
Mondom AF035195,IGHG    c       (V)DAGGPSVFVFPPNPQDVLKL.SRSPKVTCMVV DVSDA.SGVQ  ITWFKGEEEV....SSPKLTQKKLNN......GTFQVVSNLPVVHQEW..LKGTSYTC KVNTSE..LPVVE RKTISHTK
Camdro AJ131945,IGHG2         (A)PELLGGPSVFIFPPKPKDVLSI.SGRPEVTCVVV DVGQEDPEVS  FNWYIDGVEVR...TANTKPKEEQFN......STYRVVSVLTIQHQDW..LTGKELKC KVNNKA..LPAPI ERTISKAK
Camdro Z48947  ,IGHG3   c     (A)PELPGGPSVFVFPPKPKDVLSI.SGRPEVTCVVV DVGKEDPEVN  FNWYIDGVEVR...TANTKPKEEQFN......STYRVVSVLTIQHQDW..LTGKEFKC KVNNKA..LPAPI ERTISKPK
Orycun L29172  ,IGHG          (P)PELLGGPSVFIFPPKPKDTLMI.SRTPEVTCVVV DVSEDDPEVQ  FTWYINNEQVR...TARPPLREQQFN......STIRVVSTLPIAHEDW..LRGKEFKC KVHNKA..LPAPI EKTISKAR
Homsap X57331  ,IGHM           (V)IAELPPKVSVFVPPRDGFFGN.PRKSKLICQAT GFSP..RQIQ  VSWLREGKQVGS..GVTTDQVQAEAKES..GPTTYKVTSTLTIKESDW..LGQSMFTC RVDHR....GLTF QQNASSMCVP
Macmul AF046784,IGHM    c (m)  (V)LAERPPNVSVFVPPRDGFVGN.PRESKLICQAT GFSP..RQIE  VSWLREGKQVGS..GITTDRVEAEAKES..GPTTFKVTSTLTVSERDW..LSQSVFTC RVDHR....GLTF QKNVSSVCGP
Equcab L49414  ,IGHM    c     (V)LIQDESPNVTVFIPPRDAFTGPGQRTSRLVCQAT GFSP..KEIS  VSWLRDGKPVES..GFTTEEVQPQNKES..WPVTYKVTSMLTITESDW..LNQKVFTC HVEHT....GGSF QKNVSSMCSP
Musmus V00818  ,IGHM           (A)VAEMNPNVNVFVPPRDGFSGPAPRKSKLICEAT NFTP..KPIT  VSWLKDGKLVES..GFTTDPVTIENKGS..TPQTYKVISTLTISEIDW..LNLNVYTC RVDHR....GLTF LKNVSSTCAA
Ratnor M13800  ,IGHM           (A)VVEMNPNVSVFIPPRDAFSGPAPRKSRLICEAT NFSP..KQIT  VSWLQDGKPVKS..GFTTEPVTVEAKGS..RPQTYKVISTLTITESDW..LNLNVFTC RVDHR....GLTC LKNVSSTCAA
Bostau U63637  ,IGHM           (K)AEVLSPVVSVFVPPRNSLSGDGNSKSSLICQAT DFSP..KQIS  LSWFRDGKRIVS..GISEGQVETVQSS....PITFRAYSMLTITERDW..LSQNAYTC QVEHN....KETF QKNVSSSCDV
Oviari X59994  ,IGHM    c      (E)VEVLSPVVSVFVPPCNSLSGNGNSKSSLICQAT DFSP..KQIS  LSWFRDGKRIVS..DISEGQVETVQSS....PTTYRAYSVLTITEREW..LSQSAYTC QVEHN....KETF QKNASSSCDA
Susscr AB699686,IGHM           (V)VEEQPPVLNIFVPTRESFSSTPQRTSKLICQAS DFSP..KQIS  MAWFRDGKRVVS..GVSTGPVETLQSS....PVTYRLHSMLTVTESEW..LSQSVFTC QVEHK....GLNY EKNASSLCTS
Trivul AF157618,IGHM    c      (D)HIINSPNVTVYIPPSDAFSSSSPRTSKLICQAT NFRP..NKIK  LTWLQEGRPVLS..GISTGQVLPDGS......GTYLLQSSLTINENDW..LSQNTFTC RVEHE....GAQF QKNVSSTCFS
Mondom AF012109,IGHM    c      (D)TTSSSPNVTVYIPPRDAFSNSGLRKSKLICQVT DFRP..REIK  LTWLREGRPVSS..GFSTGQVLPDGS......GTYFLQSSLTINESDW..LSQSTFTC RVDHL....NAQF QKNVSSSCAI
Orycun J00666  ,IGHM    c      (V)DSELPPNVSVFIPPRDSFSGSGTRKSRLICQAT GFSP..KQIS  VSWLRDGQKVES..GVLTKPVEAETKGA..GPATFSISSMLTITESDW..LSQSLYTC RVDHR....GIFF DKNVSMSSECS
       CH3
Homsap J00220  ,IGHA1           (G)NTFRPEVHLLPPPSEELAL..NELVTLTCLAR GFSP..KDVL  VRWLQGSQELPRE.KYLTWASRQEPSQG...TTTFAVTSILRVAAEDW..KKGDTFSC MVGHEA.LPLAFT QKTIDRLA...GKPTHVNVSVVMAEVDGTCY
Homsap J00221  ,IGHA2           (G)NTFRPEVHLLPPPSEELAL..NELVTLTCLAR GFSP..KDVL  VRWLQGSQELPRE.KYLTWASRQEPSQG...TTTFAVTSILRVAAEDW..KKGDTFSC MVGHEA.LPLAFT QKTIDRLA...GKPTHVNVSVVMAEVDGTCY
Macfas X53705  ,IGHA            (G)NTFRPEVHLLPPPSEELAL..NELVTLTCLAR GFSP..EDVL  VRWLKGTEQLPRD.KYLTWESRKEPSQG...TTTFAVTSILRVAAEDW..KKGDTFSC MVGHEA.LPLAFT QKTIDRLA...GKPTHVNVSVVMAEVDGTCY
Macmul AY039245,IGHA            (G)NTFRPEVHLLPPPSEELAL..NELVTLTCLAR GFSP..EDVL  VRWLKGTEQLPRD.KYLTWESRKEPSQG...TTTFAVTSILRVAAEDW..KKGDTFSC MVGHEA.LPLAFT QKTIDRLA...GKPTHVNVSV
Pantro X53702  ,IGHA1           (G)NTFRPEVHLLPPPSEELAL..NELVTLTCLAR GFSP..KDVL  VRWLQGSQELPRE.KYLTWASRQEPSQG...TTTFAVTSILRVAAEDW..KKGDTFSC MVGHEA.LPLAFT QKTIDRLA...GKPTHVNVSVVMAEVDGTCY
Pantro X53706  ,IGHA2           (G)NTFRPEVHLLPPPSEELAL..NELVTLTCLAR GFSP..KDVL  VRWLQGSQELPRE.KYLTWASRQEPSQG...TTTYAVTSILRVAAEDW..KKGDTFSC MVGHEA.LPLAFT QKTIDRLA...GKPTHINVSVVMAEVDGTCY
Canfam L36871  ,IGHA             (E)HIPPQVHLLPPPSEELAL..NELVTLTCLVR GFKP..KDVL  VRWLQGTQELPQE.KYLTWEPLKEPDQ....TNMFAVTSMLRVTAEDW..KQGEKFSC MVGHEA.LPMSFT QKTIDRLA...GKPTHVNVSVVMAEVDGICY
Musmus J00475  ,IGHA            (V)NTFPPQVHLLPPPSEELAL..NELLSLTCLVR AFNP..KEVL  VRWLHGNEELSPE.SYLVFEPLKEPGEG...ATTYLVTSVLRVSAETW..KQGDQYSC MVGHEA.LPMNFT QKTIDRLS...GKPTNVSVSVIMSEGDGICY
Ratnor M13801  ,IGHA            (E)NTFPPQVHLVPPPSEELAL..NELVSLTCLVR GFNP..KDVL  VRWLQGNEELPSE.SYLVFEPLREPGEG...AITYLVTSVLRVSAETW..KQGAQYSC MVGHEA.LPMSFT QKTIDRLS...GKPTNVNVSVIMSEGDGICY
Bostau AF109167,IGHA            (G)NTFRPQVHLLPPPSEELAL..NELVTLTCLVR GFSP..KEVL  VRWLQGNQELPRE.KYLTWGPLPEAGQS...VTTFAVTSVLRVDAEVW..KQGDTFSC MVGHEA.LPLAFT QKTIDRLA...GKPTHVNVSVVMSEVDGVCY
Oviari AF024645,IGHA    c       (V)NTFRPQVHLLPPPSEELAL..NELVTLTCLVR GFSP..RDVL  VRWLQGNQELPRE.KYLTWGPLPEPGQS...VTTFAVTSVLRVDAEVW..KQGDTFSC MVGHEA.LPLAFT QKTIDRLA...GKPTHVNVSVVMSEVDGVCY
Susscr AB699687,IGHA            (V)NTFRPQVHLLPPPSEELAL..NELVTLTCLVR GFSP..KDVL  VRWLQGGQELPRD.KYLVWESLPEPGQA...IPTYAVTSVLRVDAEDW..KQGDTFSC MVGHEA.LPLAFT QKTIDRLA...GKPTHVNVSVVMAEAEGICY
Trivul AF027382,IGHA    c       (V)TQIPPQVYVLPPSADELAL..NELVTIVCLVR GHSP..QEAL  VQWMNGSEKLPRE.DYITSDPHPEPRG....TNTFIISSILQVSASEW..KAENKYSC VVGHEA.LPLNFT QQTIDRFS...GKPTNVNVSVIMSDVSGTCY
Mondom AF012110,IGHA    c       (V)PQIPPQIYLLAPSADEQAL..NEMVSITCLVR GFSP..EDVF  IRWLKGSEELPKK.DYITSNPYPEPKS....TSTYMVSSILQVQSTDW..KNENKYSC VVGHEA.LPLNFT QQTIDRLC...GKPTNVNVSVIMSDIYGTCY
Orycun X51647  ,IGHA1           (G)SLTPPQVHLLPPPSEELAL..NALVTLTCLVR GFSP..KDVL  VYWTNKGVVVPKD.SFLVWKPLPEPGQE...PTTYAVTSLLRVSAEDW..NQGDSYSC VVGHEG.LAEHFT QKTIDRQA...GKPTHVNVSVVVADVEGVCY
Orycun X82108  ,IGHA2           (G)SLIPPQVHLLPPPSEELAL..NALVTLTCLVR GFSP..KDVL  VSWTHNGTPVVPKDSYLVWKPLREPGQD...PTTYAITSLLRVPAEDW..NQGDSYSC VVGHEG.LAEHFT QKTIDRLA...GKPTHVNVSVVVADVEGVCY
Orycun X82109  ,IGHA3           (G)SLTPPQVHLLPPPTEELAL..NALVTLTCLVR GFSP..KDVL  VSWTHNGTLVVPKDSFLVWKPLPEPGQE...PTTYAVTSLLRVPAEDW..NQGDSYSC VVGHEG.LAEHFT QKTIDRLA...GKPTHVNVSVVVADVEAVCY
Orycun X82110  ,IGHA4           (G)SLIPPQVHLLPPPSEELAL..NALVTLTCLVR GFSP..KDVL  VYWTNKGLQVPKD.SFLVWKPLPEPGQE...PTTYAVTSLLRVPAEDW..NQNESYTC VVGHEG.LAEHFT QKTIDRLA...GKPTHVNVSVVVADVEGVCY
Orycun X82111  ,IGHA5           (G)VVIAPQVHLLPPPSDELAL..NALVTLTCLVR GFSP..KDVL  VYWTNKGVEVPKD.SFLVWKPLPEPGQE...PTTYAVTSLLRVPAEDW..NQNESYTC VVGHEG.LAEHFT QKTIDRLA...GKPTHVNVSVVVADVEGVCY
Orycun X82112  ,IGHA6           (G)AIIPPQVHLLPPPSEELAL..NELVTLTCLVR GFSP..KDVL  VYWTNKGVNVPEN.SFLVWKPLPEPGQE...PTTYAVTSLLRVPAEDW..NQNESYTC VVGHEG.LAEHFT QKTIDRLS...GKPTHVNVSVVVADVEGVCY
Orycun X82113  ,IGHA7           (G)SLTPPQVHLLPPPSEELAL..NALVTLTCLVR GFSP..KDVL  VYWRKKDVEVPEN.SFLVWKPLPEPGQD...PTTYAVTSLLRVSAEDW..NQGDSYTC VVGHEG.LAEHFT QKTIDREA...GKPTHVNVSVVVADVEAVCY
Orycun X82114  ,IGHA8           (G)SLTPPLVHLLPPPSEELAL..NALVTLTCLVR GFSP..KDVL  VSWTHNGTPVVPKDSFLVWKPLPEPGQD...PTTYAATSLLRMSAEDW..NQGDSYNC VVGHEG.LAEHFT QKTIDRLA...GKPTHVNVSVVVADVEGVCY
Orycun X82115  ,IGHA9           (G)SLTPPQVHLLPPPTEELAL..NEQVTLTCLVQ GFSP..KDVL  VSWTHNGTLVVPKDSYLVWKPLPEPGQD...PTTYAVTSLLRVSAEDW..NQGDSYSC VVGHEG.LAEHFT QKTIDRQA...GKPTHVNVSVVVADVEAVCY
Orycun X82116  ,IGHA10          (G)IIIPPLVHLLPPPSDELAL..NALVTLTCLVR GFSP..KDVL  VYWTNKGVNVPEN.SFLLWKPLPEPGQE...PTTYAITSLLRVPAEDW..NQNESYTC VVGHEG.LAEHFT QKTINREA...GKPTHVNVSVVVADVEGVCY
Orycun X82117  ,IGHA11          (G)SLTPPLVHLLPPPSEELAL..NALVTLTCLVR GFSP..KDVL  VSWTNKGVKVPEN.SFLVWKPLPEPGQD...PTTYAVTSLLRVPAEDW..NQNESYSC VVAHEG.LAEHFT QKTIDRLA...GKPTHVNVSVVVADVEAVCY
Orycun X82118  ,IGHA12          (G)SLTPPQVHLLPPPSEELAN..NALVTLTCLGQ GFSP..KDVL  VYWTNKGTVVLKE.SYLVWKPLPEPGQE...PTTYAVTSLLRVPAEDW..NQNESYTC VVGHEG.LAEHFT QKTINREA...GKPTQVNVSVVVADVEAVCY
Orycun X82119  ,IGHA13          (G)VVTPPQVHLLPPPSEELAL..NEQVTLTCLVR GFSP..KDVL  VSWRHQGQEVPED.SFLVWKSMPESSQD...KATYAITSLLRVPAEDW..NQGDTYSC MVGHEG.LAEHFT QKTIDRLA...GKPTHVNVSVVVADVEAVCY
Homsap K02879  ,IGHD             (A)AQAPVKLSLNLLASSDPP..EAASWLLCEVS GFSP..PNIL  LMWLEDQREVNTS.GFAPARPPPQPRS.....TTFWAWSVLRVPAPPS..PQPATYTC VVSHEDSRTLLNA SRSLEVS   (Y)VTDHGPMK
Musmus V00788  ,IGHD      (4)    (G)AMAPSNLTVNILTTSTHP..EMSSWLLCEVS GFFP..ENIH  LMWLGVHSKMKST.NFVTANPTAQPG......GTFQTWSVLRLPVALS..SSLDTYTC VVEHEASKTKLNA SKSLAIS   (G)CYHLLPESDGPSRRPDGPALA (J00450)
Susscr AB699686,IGHD          (A)ALAPSNLAVRVLTAPGPLAFT..KAASWLLCEVS SFSP..LDIL  LTWLEGQQEVDPS.WFATARPAAQPGN.....PTFRTWSVLRVPASPG..HQDATYTC VVGHEA..SRTLL NASWRLDT  (G)PLLIQQRLGAEWKASKRAPASPEA
Homsap J00222  ,IGHE           (D)SNPRGVSAYLSRPSPFDLFI..RKSPTITCLVV DLAPSKGTVN  LTWSRASGKPV...NHSTRKEEKQRN......GTLTVTSTLPVGTRDW..IEGETYQC RVTHPH..LPRAL MRSTTKTS
Pantro M15398  ,IGHE	       (D)SNPRGVSAYLSRPSPFDLFI..RKSPTITCLVV DLAPSKGTVN  LTWSRASGKPV...NHSTRKQEKQRN......GTLTVTSTLPVGTRDW..IEGETYQC RVTHPH..LPRAL VRSTTKTS
Canfam L36872  ,IGHE           (E)SDPRGVTSYLSPPSPLDLYV..HKAPKITCLVV DLATM.EGMN  LTWYRESKEPV...NPGPLNKKDHFN......GTITVTSTLPVNTNDW..IEGETYYC RVTHPH..LPKDI VRSIAKAP
Equcab AJ305046,IGHE           (E)SDPRGVSVYLSPPSPLDLYV..SKSPKITCLVV DLANV.QGLS  LNWSRESGEPL...QKHTLATSEQFN......KTFSVTSTLPVDTTDW..IEGETYKC TVSHPD..LPREV VRSIAKAP
Musmus X01857  ,IGHE           (D)HEPRGVITYLIPPSPLDLYQ..NGAPKLTCLVV DLESE.KNVN  VTWNQEKKTSV...SASQWYTKHHNN......ATTSITSILPVVAKDW..IEGYGYQC IVDHPD..FPKPI VRSITKTP
Ratnor K02901  ,IGHE           (D)DEPRGVITYLIPPSPLDLYE..NGTPKLTCLVL DLESE.ENIT  VTWVRERKKSI...GSASQRSTKHHN......ATTSITSILPVDAKDW..IEGEGYQC RVDHPH..FPKPI VRSITKAP
Bostau U63640  ,IGHE           (A)ESEPRVSAYLSPPTPLELYV..NKSPKITCLVV DLANE.KNLS  LTWSRANGKPV...HAGPPEIKRQFN......GTVTVTSTLPVDVTDW..VEGETYYC KVSHRD..LPTDI QRSISKDV
Oviari M84356  ,IGHE    c      (E)SEPRGVSTYLIPPTPLELYV..NKSPKITCLVV DLAST.NNLS  LTWSRANGKPV...HADPLDIKHQFN......GTITVTSTLPVNVIDW..VEGETYYC KVSHGD..LPKDI QRSISKDV
Susscr AB699687,IGHE          (A)ESEPRGVSAYLSPPTPLDLYV..HKSPKLTCLVV DLASS.ENVN  LLWSRENKGGVILPPPGPPVIKPQFN......GTFSATSTLPVNVSDW..IEGETYYC NVTHPD..LPKPI LRSISKGP
Trivul AF157617,IGHE    c      (D)TDPRGISAYLSPPSAFDLYV..SKAPVLTCLVV DLASA.ENVK  VSWTRESGGTV...SPSSPVVKEQYN......GTVTITSTLPVQTDDW..VEGETYTC HLEHPD..LPFPL IRTISKAP
Mondom AF035194,IGHE    c      (D)TDPRGISAYILPPTPQDLFV..KKVPTIGCLIV DLASA.ENVK  VTWSRESGGPV...NPSSLVVKEQYN......GTFTVTSHLPVNTDDW..IEGDTYTC RLESPD..MPVPL IRTISKAP
Homsap J00228  ,IGHG1           (G)QPREPQVYTLPPSRDELT...KNQVSLTCLVK GFYP..SDIA  VEWESNGQPEN...NYKTTPPVLDSD......GSFFLYSKLTVDKSRW..QQGNVFSC SVMHEA.LHNHYT QKSLSLSP...GK
Homsap J00230  ,IGHG2           (G)QPREPQVYTLPPSREEMT...KNQVSLTCLVK GFYP..SDIA  VEWESNGQPEN...NYKTTPPMLDSD......GSFFLYSKLTVDKSRW..QQGNVFSC SVMHEA.LHNHYT QKSLSLSP...GK
Homsap X03604  ,IGHG3           (G)QPREPQVYTLPPSREEMT...KNQVSLTCLVK GFYP..SDIA  VEWESSGQPEN...NYNTTPPMLDSD......GSFFLYSKLTVDKSRW..QQGNIFSC SVMHEA.LHNRFT QKSLSLSP...GK
Homsap K01316  ,IGHG4           (G)QPREPQVYTLPPSQEEMT...KNQVSLTCLVK GFYP..SDIA  VEWESNGQPEN...NYKTTPPVLDSD......GSFFLYSRLTVDKSRW..QEGNVFSC SVMHEA.LHNHYT QKSLSLSL...GK
Macfas AF045536,IGHG1   c       (G)QPREPQVYTLPPSREELT...KNQVSLTCLVK GFYP..SDIV  VEWESSGQPEN...TYKTTPPVLDSD......GSYFLYSKLTVDKSRW..RQGNVFSC SVMHEA.LHNHYT QKSLSLSP...GK
Macmul AF045537,IGHG1   c       (G)QPREPQVYTLPPSREELT...KNQVSLTCLVK GFYP..SDIV  VEWESSGQPEN...TYKTTPPVLDSD......GSYFLYSKLTVDKSRW..QQGNVFSC SVMHEA.LHNHYT QKSLSLSP...GK
Macmul AF045539,IGHG2   c       (G)QPREPQVYTLPPPRKELT...KNQVSLTCLVK GFYP..SDIV  VEWASNGQPEN...TYKTTPPVLDSD......GSYFLYSKLTVDKSRW..QQGNTFSC SVMHEA.LHNHYT QKSLSLSP...GK
Macmul AF045538,IGHG3   c (m)   (G)QPREPQVYILPPPQEELT...KNQVSLTCLVT GFYP..SDIA  VEWESNGQPEN...TYKTTPPVLDSD......GSYFLYSKLTVDKSRW..QQGNTFSC SVMHEA.LHNHYT QKSLSVSP
Pantro X61310  ,IGHG    c       (G)QPREPQVYTLPPSRDELT...KNQVSLTCLVK GFYP..SDIA  VEWESSGQPEN...NYKTTPPVLDSD......GSFFLYSKLTVDKSRW..QQGNVFSC SVMHEA.LHNHYT QKS
Canfam AF354264,IGHG1   c       (G)RAHKPSVYVLPPSPKELSS..SDTVSITCLIK DFYP..PDID  VEWQSNGQQEPER.KHRMTPPQLDED......GSYFLYSKLSVDKSRW..QQGDPFTC AVMHET.LQNHYT DLSLSHSP...GK
Canfam AF354265,IGHG2   c       (G)QAHQPSVYVLPPSREELS...KNTVSLTCLIK DFFP..PDID  VEWQSNGQQEPES.KYRTTPPQLDED......GSYFLYSKLSVDKSRW..QRGDTFIC AVMHEA.LHNHYT QESLSHSP...GK
Canfam AF354266,IGHG3   c       (G)QAHQPNVYVLPPSRDEMS...KNTVTLTCLVK DFFP..PEID  VEWQSNGQQEPES.KYRMTPPQLDED......GSYFLYSKLSVDKSRW..QRGDTFIC AVMHEA.LHNHYT QISLSHSP...GK
Canfam AF354267,IGHG4   c       (G)QAHQPSVYVLPPSPKELSS..SDTVTLTCLIK DFFP..PEID  VEWQSNGQPEPES.KYHTTAPQLDED......GSYFLYSKLSVDKSRW..QQGDTFTC AVMHEA.LQNHYT DLSLSHSP...GK
Equcab AJ302055,IGHG1           (G)RSQEPQVYVLAPHPDELS...KSKVSVTCLVK DFYP..PEIN  IEWQSNGQPELET.KYSTTQAQQDSD......GSYFLYSKLSVDRNRW..QQGTTFTC GVMHEA.LHNHYT QKNVSKNP...GK
Equcab AJ302056,IGHG2           (G)PSRVPQVYVLPPHPDELA...KSKVSVTCLVK DFYP..PDIS  VEWQSNRWPELEG.KYSTTPAQLDGD......GSYFLYSKLSLETSRW..QQVESFTC AVMHEA.LHNHFT KTDISESL...GK
Equcab AJ312379,IGHG3           (G)QTRVPQVYVLAPHPDELS...KNKVSVTCLVK DFLP..TDIT  VEWQSNEHPEPEG.KYRTTEAQKDSD......GSYFLYSKLTVETDRW..QQGTTFTC VVMHEA.LHNHVM QKNVSHSP...GK
Equcab AJ302058,IGHG4           (G)QPREPQVYVLAPHRAELS...KNK?SVTCLVK DFYP..TDID  IEWKSNGQPEPET.KYSTTPAQLDSD......GSYFLYSKLTVETNRW..QQGTTFTC AVMHEA.LHNHYT EKSVSKSP...GK
Equcab AJ312380,IGHG5           (G)QLRVPQVYVLAPHPDELA...KNTVSVTCLVK DFYP..PEID  VEWQSNEHPEPEG.KYSTTPAQLNSD......GSYFLYSKLSVETSRW..KQGESFTC GVMHEA.VENHYT QKNVSHSP...GK
Equcab AJ312381,IGHG6           (G)ELQDPKVYILAPHREEVT...KNTVSVTCLVK DFYP..PDIN  VEWQSNEEPEPEV.KYSTTPAQLDGD......GSYFLYSKLTVETDRW..EQGESFTC VVMHEA.IRHTYR QKSITNFP...GK
Musmus J00453  ,IGHG1           (G)RPKAPQVYTIPPPKEQMA...KDKVSLTCMIT DFFP..EDIT  VEWQWNGQPAE...NYKNTQPIMNTN......GSYFVYSKLNVQKSNW..EAGNTFTC SVLHEG.LHNHHT EKSLSHSP...GK
Musmus V00825  ,IGHG2A          (G)SVRAPQVYVLPPPEEEMT...KKQVTLTCMVT DFMP..EDIY  VEWTNNGKTEL...NYKNTEPVLDSD......GSYFMYSKLRVEKKNW..VERNSYSC SVVHEG.LHNHHT TKSFSRTP...GK
Musmus V00763  ,IGHG2B          (G)LVRAPQVYTLPPPAEQLS...RKDVSLTCLVV GFNP..GDIS  VEWTSNGHTEE...NYKDTAPVLDSD......GSYFIYSKLNMKTSKW..EKTDSFSC NVRHEG.LKNYYL KKTISRSP...GK
Musmus J00479  ,IGHG2C          (G)PVRAPQVYVLPPPAEEMT...KKEFSLTCMIT GFLP..AEIA  VDWTSNGRTEQ...NYKNTATVLDSD......GSYFMYSKLRVQKSTW..ERGSLFAC SVVHEV.LHNHLT TKTISRSL...GK
Musmus X00915  ,IGHG3           (G)RAQTPQVYTIPPPREQMS...KKKVSLTCLVT NFFS..EAIS  VEWERNGELEQ...DYKNTPPILDSD......GTYFLYSKLTVDTDSW..LQGEIFTC SVVHEA.LHNHHT QKNLSRSP...GK
Ratnor M28670  ,IGHG1           (G)RTQVPHVYTMSPTKEEMT...QNEVSITCMVK GFYP..PDIY  VEWQMNGQPQE...NYKNTPPTMDTD......GSYFLYSKLNVKKEKW..QQGNTFTC SVLHEG.LHNHHT EKSLSHSP...GK
Ratnor M28669  ,IGHG2A          (G)TPRGPQVYTMAPPKEEMT...QSQVSITCMVK GFYP..PDIY  TEWKMNGQPQE...NYKNTPPTMDTD......GSYFLYSKLNVKKETW..QQGNTFTC SVLHEG.LHNHHT EKSLSHSP...GK
Ratnor M28671  ,IGHG2B          (G)LVRKPQVYVMGPPTEQLT...EQTVSLTCLTS GFLP..NDIG  VEWTSNGHIEK...NYKNTEPVMDSD......GSFFMYSKLNVERSRW..DSRAPFVC SVVHEG.LHNHHV EKSISRPP...GK
Ratrat X07189  ,IGHG2C  c       (G)KARTPQVYTIPPPREQMS...KNKVSLTCMVT SFYP..ASIS  VEWERNGELEQ...DYKNTLPVLDSD......ESYFLYSKLSVDTDSW..MRGDIYTC SVVHEA.LHNHHT QKNLSRSP...GK
Bostau X16701  ,IGHG1           (G)PAREPQVYVLAPPQEELS...KSTVSLTCMVT SFYP..DYIA  VEWQRNGQPESED.KYGTTPPQLDAD......SSYFLYSKLRVDRNSW..QEGDTYTC VVMHEA.LHNHYT QKSTSKSA...GK
Bostau M36946  ,IGHG2           (G)PAREPQVYVLDPPKEELS...KSTVSVTCMVI GFYP..EDVD  VEWQRDRQTESED.KYRTTPPQLDAD......RSYFLYSKLRVDRNSW..QRGDTYTC VVMHEA.LHNHYM QKSTSKSA...GK
Bostau U63638  ,IGHG3           (G)QAREPQVYVLAPPREELS...KSTLSLTCLIT GFYP..EEID  VEWQRNGQPESED.KYHTTAPQLDAD......GSYFLYSKLRVNKSSW..QEGDHYTC AVMHEA.LRNHYK EKSISRSP...GK
Oviari X69797  ,IGHG1   c       (G)QAREPQVYVLAPPQEELS...KSTLSVTCLVT GFYP..DYIA  VEWQKNGQPESED.KYGTTTSQLDAD......GSYFLYSRLRVDKNSW..QEGDTYAC VVMHEA.LHNHYT QKSISKPP...GK
Oviari X70983  ,IGHG2   c       (G)QAREPQVYVLAPPQEELS...KSTLSVTCLVT GFYP..DYIA  VEWQRARQPESED.KYGTTTSQLDAD......GSYFLYSRLRVDKSSW..QRGDTYAC VVMHEA.LHNHYT QKSISKPP...GK
Susscr AB699686,IGHG1     (5)   (G)QSREPQVYTLPPPAEELS...RSKVTVTCLVI GFYP..PDIH  VEWKSNGQPEPEG.NYRTTPPQQDVD......GTFFLYSKLAVDKARW..DHGETFEC AVMHEA.LHNHYT QKSISKTQ...GK
Susscr U03779  ,IGHG2   c (5)   (G)QTREPQVYTLPPHAEELS...RSKVSITCLVI GFYP..PDID  VEWQRNGQPEPEG.NYRTTPPQQDVD......GTYFLYSKFSVDKASW..QGGGIFQC AVMHEA.LHNHYT QKSISKTP...GK
Susscr AB699686,IGHG3     (5)   (G)PSRVPQVYTLPPAWEELS...KSKVSITCLVT GFYP..PDID  VEWQSNGQQEPEG.NYRTTPPQQDVD......GTYFLYSKLAVDKVRW..QRGDLFQC AVMHEA.LHNHYT QKSVSQTP...GK
Susscr EU372654,IGHG4     (5)   (G)QTREPQVYTLPPPTEELS...RSKVTLTCLVT GFYP..PDID  VEWQRNGQPEPEG.NYRTTPPQQDVD......GTYFLYSKLAVDKASW..QRGDTFQC AVMHEA.LHNHYT 
Susscr AB699686,IGHG5-1   (5)   (G)VVRSPEVYTLPPPAEELS...KSIVTLTCLVK SFFP..PFIH  VEWKINGKPEPEN.AYRTTPPQEDED......GTYFLYSKFSVEKFRW...HSGGIHC AVMHEA.LHNHYT EKSVSQTP...GK
Susscr AB699686,IGHG5-2   (5)   (G)VVRSPEVYTLPPPAEELS...KSKVTLTCLVK SFFP..PFIH  VGWKINGQLEPEG.NYHTTPPQEDED......GTYFLYSKLAVDKARL...QSGGIHC AVMHEA.LHNHYT EKSVSLTP...GK
Susscr AB699687,IGHG6-1   (5)   (G)QTREPQVYTLPPPTEELS...RSKLSVTCLIT GFYP..PDID  VEWQRNGQPEPEG.NYRTTPPQQDVD......GTYFLYSKLAVDKASW..QRGDPFQC AVMHEA.LHNHYT QKSIFKTP...GN
Susscr AB699687,IGHG6-2   (5)   (G)PSREPQVYTLSPSAEELS...RSKVSITCLVT GFYP..PDID  VEWKSNGQPEPEG.NYRTTPPQQDVD......GTYFLYSKLAVDKASW..QRGDPFQC AVMHEA.LHNHYT QKSVSKTQ...GK
Trivul AF157619,IGHG    c       (G)NRKKPDVYVFAPHPDELKQ..KDTVSITCLVK SFFP..KEVV  VEWQCNNNPESED.NYSTTEAMREND.......TFFVYSKLNVKKTKW..QENNHYTC TVLHEA.LPNQTS QRTISASSP..GK
Mondom AF035195,IGHG    c       (G)ERKKPDIYVFGPHPDELKQ..KDDVSITCLVT NFFP..EDVV  IEWQKNNNPESED.KYYTTPTTREKS.......TYFFYSKLIVKKRDW..DNQNSYTC VVLHEA.FPNQIS QRTISASP...GK
Camdro AJ131945,IGHG2           (G)QTREPQVYTLAPHREELA...KDTVSITCLVI GFYP..ADIN  VEWQRNGRPESEG.AYATTLPQLDND......GTYFLYSKLSVGKNTW..QQGETFTC VVMHEA.LHNHST QKSITQSS...GK
Camdro Z48947  ,IGHG3   c       (G)QTREPQVYTLAPHREELA...KDTVSVTCLVK GFYP..PDIN  VEWQRNRQPESEG.AYATTLPQLDND......GTYFLYSKLSVGKNTW..QRGETFTC VVMHEA.LHNHYT QKSITQSS...GK
Orycun L29172  ,IGHG            (G)QPLEPKVYTMGPPREELS...SRSVSLTCMIN GFYP..SDIS  VEWEKNGKAED...NYKTTPAVLDSD......GSYFLYSKLSVPTSEW..QRGDVFTC SVMHEA.LHNHYT QKSISRSP...GK
Homsap X57331  ,IGHM            (D)QDTAIRVFAIPPSFASIFL..TKSTKLTCLVT DLTTY.DSVT  ISWTRQNGEAV...KTHTNISESHPN......ATFSAVGEASICEDDW..NSGERFTC TVTHTD..LPSPL KQTISRPK
Macmul AF046784,IGHM    c (m)   (N)PDTAIRVFAIPPSFASIFL..TKSTKLTCLVT DLATY.DSVT  ITWTRQNGEAL...KTHTNISESHPN......GTFSAVGEASICEDDW..NSGERFRC TVTHTD..LPSPL KQTISRPK
Equcab L49414  ,IGHM    c       (I)HQSPIQIFAIPPSFAGIFL..TKSAKLSCQVT NLGTY.DSLS  ISWTRQNGEIL...KTHTNISESHPN......GTFSALGEATICVEDW..ESGDDYIC TVTHTD..LPFPL KQVISRPD
Musmus V00818  ,IGHM            (S)PSTDILTFTIPPSFADIFL..SKSANLTCLVS NLATY.ETLN  ISWASQSGEPL...ETKIKIMESHPN......GTFSAKGVASVCVEDW..NNRKEFVC TVTHRD..LPSPQ KKFISKPN
Ratnor X68312  ,IGHM    c       (S)PSTDILAFPIPPSFADIFL..TKSAKLSCLVT NLATY.DTLN  ISWSSKSGEPL...ETNTKIMESHPN......GTFSAVGVASVCMEDW..DNRKEFVC TVTHRD..LPSPQ KKFISKPN
Bostau U63637  ,IGHM            (A)PPSPIGVFTIPPSFADIFL..TKSAKLSCLVT NLASY.DGLN  ISWSRQNAKAL...ETHTYFERHLND.......TFSARGEASVCSEDW..ESGEEFTC TVAHSD..LPFPE KNAVSKPK
Oviari X59994  ,IGHM    c       (T)PPSPIGVFTIPPSFADIFL..TKSAKLSCLVT NLASY.DGLN  ISWSHQNGKAL...ETHTYFERHLND.......TFSARGEASVCSEDW..ESGEEYTC TVAHLD..LPFPE KSAISKPK
Susscr AB699686,IGHM            (N)PNSPITVFAIAPSFAGIFL..TKSAKLSCLVT GLVTR.ESLN  ISWTRQDGEVL...KTSIVFSEIYAN......GTFGARGEASVCVEDW..ESGDRFTC TVTHTD..LPSPL KQSVSKPR
Trivul AF157618,IGHM    c      (E)GPELPSEAFAIAPTFASIFV..TKSAKLTCLVT NLPTA.QNPN  ITWTRANGQPL...ETTIKLSLSHLN......GTFSAEGEATVCAEDW..NAGEIFKC TVIHPN..HPVPL KKEIFKQQ
Mondom AF012109,IGHM    c       (S)TDSPIEAFAIPPSFASIFV..TKSAKLTCVVT NLPTY.DSLS  ISWTRKDGQLL...KTKVKVFSSHPN......GTFTAEGEATVCAEEW..NSGEAFKC IVTHSD..HPVPL KKEIFKPQ
Orycun J00666  ,IGHM    c      (T)TPSPGIQVFPIAPSFADTFL..SKSARLICLVT DLTTY.GSLN  ISWASHNGKAL...DTHMNITESHPN......ATFSAMGEASVCAEDW..ESGEQFTC TVTHAD..LPFPL KHTISKSR
       CH4
Homsap J00222  ,IGHE            (G)PRAAPEVYAFATPEWPGS...RDKRTLACLIQ NFMP..EDIS  VQWLHNEVQLPDA.RHSTTQPRKTKG......SGFFVFSRLEVTRAEW..EQKDEFIC RAVHEAASPSQTV QRAVSVNP...GK
Pantro M15398  ,IGHE            (G)PRAAPEVYAFATPEGPGS...RDKRTLACLIQ NFMP..EDIS  VQWLHNEVQLPDA.RHSTTQPHKTKG......SGFFVFSRLEVTRAEW..EQKDEFIC RAVHEAASPSQTV QRTVSVNP...GK
Canfam L36872  ,IGHE            (G)KRAPPDVYLFLPPEEEQGT..KDRVTLTCLIQ NFFP..ADIS  VQWLRNDSPIQTD.QYTTTGPHKVSGS....RPAFFIFSRLEVSRVDW..EQKNKFTC QVVHEALSGSRIL QKWVSKTP...GK
Equcab AJ305046,IGHE            (G)KRLSPEVYVFLPPEEDQSS..KDKVTLTCLIQ NFFP..ADIS  VQWLRNNVLIQTD.QQATTRPQKANGP....NPAFFVFSRLEVSRAEW..EQKNKFAC KVVHEA.LSQRTL QKEVSKDP...GK
Musmus X01857  ,IGHE            (G)QRSAPEVYVFPPPEEES....EDKRTLTCLIQ NFFP..EDIS  VQWLGDGKLISNS.QHSTTTPLKSNGS....NQGFFIFSRLEVAKTLW..TQRKQFTC QVIHEALQKPRKL EKTISTSL...GNTSLRPS
Ratnor K02901  ,IGHE            (G)KRSAPEVYVFLPPEEEE....KDKRTLTCLIQ NFFP..EDIS  VQWLQDSKLIPKS.QHSTTTPLKYNGS....NQRFFIFSRLEVTKALW..TQTKQFTC RVIHEALREPRKL ERTISKSL...GNTSLRPSQASM
Bostau U63640  ,IGHE            (G)KRLAPKDYVFLADGKELEN..EEELTLTCMIQ NFFP..RDIF  VRWLHNKELMGAD.QHTTTQPHRDDNN....TPAFFAYSRLAVPRANW..KRGDEFTS QVIHEALPRTRTL EKSVFINS...GK
Oviari M84356  ,IGHE    c       (G)KRVAPKVYVFWPDRKELEN..QEELTLTCLIQ KFFP..KDIS  VRWLRNKELMREG.QHTTTQPDRADNN....SLAFFAYSRLAVPKASW..KMDDEFTC QVIHEALPKTRTL EKSVFINS...GK
Susscr AB699687,IGHE            (G)KRVTPEVYVLWSPDELK....KGRLTLTCLIQ NFFP..ADIS  VLWLRNDAPVQAD.RHSTTRPHKASDS....LPSFFVYSRLVVSQSDW...EQNKFAC EVIHEALPGSRTL QKEVSKNP...GK
Trivul AF147617,IGHE    c       (G)KRIAPEVYMFPPSEEEK....GNTVSLTCLIR AFYP..ADIT  VQWLRDNKDDHTG.HHTTTRPHKDHGP....DPSFFLYSRMVVNRSHW..QEGHTFTC RVVHEALPGTRTL DKSLHYST...GN
Mondom AF035194,IGHE    c       (G)KRLAPEVYMLPPSPEET....GTTRTVTCLIR GFYP..SEIS  VQWLFNNEEDHTG.HHTTTRPQKDHGT....DPSFFLYSRMLVNKSIW..EKGNLVTC RVVHEALPGSRTL EKSLHYSA...GN
Homsap X57331  ,IGHM           (G)VALHRPDVYLLPPAREQLNL..RESATITCLVT GFSP..ADVF  VQWMQRGQPLSPE.KYVTSAPMPEPQA....PGRYFAHSILTVSEEEW..NTGETYTC VVAHEA.LPNRVT ERTVDKST...GKPTLYNVSLVMSDTAGTCY
Macmul AF046784,IGHM    c (m)  (G)VAMHRPDVYLLPPAREQLNL..RESATITCLVT GFSP..ADIF  VQWMQRGQPLSPE.KYVTSAPMPEPQA....PGRYFAHSILTVSEEDW..NTGETYTC VVAHEA.LPNRVT ERTVDKST
Equcab L49414  ,IGHM    c      (A)VGKHPPSVYVLPPHREQLSL..RESASITCLVK GFLTP.PDVS  VQWLQEGQPLSPD.KYVTSAPMLDPSP....QALYFVHSILTVSEEDW..SSGETYTC VVGHEA.LPHVVT ERTVDKSH...CKPTLYNVSLVMSDMASTCY
Musmus V00818  ,IGHM           (E)VHKHPPAVYLLPPAREQLNL..RESATVTCLVK GFSP..ADIS  VQWLQRGQLLPQE.KYVTSAPMPEPGA....PGFYFTHSILTVTEEEW..NSGETYTC VVGHEA.LPHLVT ERTVDKST...GKPTLYNVSLIMSDTGGTCY
Ratnor X68312  ,IGHM    c      (E)VAKHPPAVYLLPPAREQLIL..RESATVTCLVK GFSP..ADIF  VQWLQRGQPLSSD.KYVTSAPMPEPGA....PGLYFTHSILTVTEEEW..NSGETYTC VVGHEA.LPHMVT ERTVDKST...GKPTLYNVSLIMSDTGGTCY
Bostau U63637  ,IGHM           (D)VAMKPPSVYLLPPTREQLSL..RESASVTCLVK AFAP..ADVF  VQWLQRGEPVTKS.KYVTSARAPEPQDP...SVVYFVHSILTVAEEDW..SKGETYTC VV.HEA.LPHMVT ERTVDKST...GKPTLYNVSLVLSDTASTCY
Oviari X59994  ,IGHM    c      (D)VAMKPPSVYVLPPTREQLSL..RESASVTCLVK GFAP..ADVF  VQWLQKGEPVAKS.KYVTSSPAPEPQD....PSAYFVHSILTVTEEDW..SKGETYTC VVGHEA.LPHMVT ERTVDKST...GKPTLYNVSLVMSDTASTCY
Susscr AB699686,IGHM           (G)IARHMPSVYVLPPAPEELSL..QEWASVTCLVK GFSP..ADVF  VQWLQKGEPVSAD.KYVTSAPVPEPEPK..APASYFVQSVLTVSAKDW..SDGETYTC VVGHEA.LPHTVT ERTVDKST...GKPTLYNVSLVLSDTASTCY
Trivul AF147618,IGHM    c      (G)AVMHAPAVYLLPPAPEELTL..REAATLTCLMR DFSP..ADVF  VQWRHKGQPIPSE.KYVTSSPQQEPQK....AGLYFSHSTLTVSEENW..NAGDSYTC VVVHEA.LPLSVT EKTVDKST...GKPTLVNVSLVLSDASNTCY
Mondom AF012109,IGHM    c      (E)VDLHAPSVYLLHPNPEELSL..RESVTVTCMMK DFSP..PDVF  VQWMHKGQPIPSE.KYVTSSPHQDPQK....GGRYFSYSILTVSEAQW..NSGDPFTC VVAHEA.LPLSST ERTVDKST...GKPTLVNVSLVLADTTNTCY
Orycun J00666  ,IGHM    c      (E)VAKHPPAVYVLPPAREQLVL..RESATVTCLVK GFSP..ADVF  VQWQQRGQPLSSD.KYVTSAPAPEPQA....PGLYFTHSTLTVTEEDW..NSGETFTC VVGHEA.LPHMVT ERTVDKST...GKPTLYNVSLIMSDTASTCY
       Hinge
Homsap J00220  ,IGHA1         (V)PSTPPTPSPSTPPTPSPS
Homsap J00221  ,IGHA2         (V)PPPPP
Macfas X53705  ,IGHA          (V)SETKPCL
Macmul AY039245,IGHA*01	      (V)PPPKCPSLK
Macmul AY039246,IGHA*02       (V)PPPNCRL
Macmul AY039247,IGHA*03       (V)PQPKPCL
Macmul AY039248,IGHA*04       (V)PPITPPCPS
Macmul AY039251,IGHA*07       (V)SQTKPCL
Macmul AB013761,IGHA*11       (G)IPPTPIPLPCPS
Macmul AB013768,IGHA*12	      (V)PPPNSCL
Pantro X53702  ,IGHA1	      (V)PSTPCPPTPSTPPTPSPS
Pantro X53706  ,IGHA2         (V)PPPPP
Canfam L36871  ,IGHA          (D)NSHPCHPCPS
Musmus J00475  ,IGHA*01       (G)PTPPPPITIP
Musmus AF175974,IGHA*04       (G)ICSPPTTPPPP
Musmus AY045712,IGHA*06       (G)PPPPCPPCPP
Musmus AY045748,IGHA*07       (G)PPPPCPP
Musmus AY045751,IGHA*08       (G)PPPPCPPLP
Bostau AF109167,IGHA          (D)SSSCCVP
Oviari AF024645,IGHA    c     (G)CPCPEECLPL
Susscr AB699687,IGHA          (V)LPSDPCPQ
Trivul AF027382,IGHA    c     (V)QDPSQC
Mondom AF012110,IGHA    c     (P)PRPCDCP
Orycun X51647  ,IGHA1         (D)THSSCPPTS
Orycun X82108  ,IGHA2         (A)CNESTIEPPTTPTCPCPCPSPS
Orycun X82109  ,IGHA3         (E)CKDPNSDPTPCPCPPIT
Orycun X82110  ,IGHA4         (A)CNKPTIEPPTKPTCPCPCPSPS
Orycun X82111  ,IGHA5         (E)CQPPTPSPTTPTTCPCPCPLPS
Orycun X82112  ,IGHA6         (E)CQPPTPGPSDTTTCPCPCPSPS
Orycun X82113  ,IGHA7         (D)PCEQCHCPS
Orycun X82114  ,IGHA8         (D)CCPANSCCTCPSSSSRNLISG
Orycun X82115  ,IGHA9         (D)CHCYCPPTS
Orycun X82116  ,IGHA10        (E)CREPIIDPTPCPTT
Orycun X82117  ,IGHA11        (D)PCEQCHCPS
Orycun X82118  ,IGHA12        (D)CSIPPIT
Orycun X82119  ,IGHA13        (D)CCPANSCCTCPSSSSRNLISG
Orycun AF314407,IGHA14        (E)DPCKNCPTISRSRFTAH
Homsap K02876  ,IGHD     [H1] (E)SPKAQASSVPTAQPQAEGSLAKATTAPATTRNT      [H2] (G)RGGEEKKKEKEKEEQEERETKTP
Musmus V00787  ,IGHD          (E)SWDSQSSKRVTPTLQAKNHSTEATKAITTKKDIE
Susscr AB699686,IGHD     [H1] (A)SRQLPAPAGTPGPTLSTVSTKALTTPRIP          [H2] (V)RSTVRGQPGAQTQEPPEGPRG  
Homsap J00228  ,IGHG1         (E)PKSCDKTHTCPPCP
Homsap J00230  ,IGHG2         (E)RKCCVECPPCP
Homsap X03604  ,IGHG3    [H1] (E)LKTPLGDTTHTCPRCP  [H2] (E)PKSCDTPPPCPRCP  [H3] (E)PKSCDTPPPCPRCP  [H4]  (E)PKSCDTPPPCPRCP
Homsap K01316  ,IGHG4         (E)SKYGPPCPSCP
Macfas AF045536,IGHG1   c     (E)IKTCGGGSKPPTCPPCP
Macmul AF045537,IGHG1   c     (E)IKTCGGGSKPPTCPPCT
Macmul AF045539,IGHG2   c     (G)LPCRSTCPPC
Macmul AF045538,IGHG3   c (m) (E)FTPPCGDTTPPCPPC
Pantro X65285  ,IGHG    c     (E)PKSCDTTHTCPPCA
Canfam AF354264,IGHG1   c     (F)NECRCTDTPPCP
Canfam AF354265,IGHG2   c     (P)KRENGRVPRPPDCPKCP
Canfam AF354266,IGHG3   c     (A)KECECKCNCNNCPCP
Canfam AF354267,IGHG4   c     (P)KESTCKCISPCP
Equcab AJ302055,IGHG1         (E)PIPDNHQKVCDMSKCPKCP
Equcab AJ302056,IGHG2         (A)RVTPVCSLCRGRYPHPI
Equcab AJ312379,IGHG3         (E)PVLPKPTTPAPTVPLTTTVPVETTTPPCPCECPKCP
Equcab AJ302058,IGHG4         (V)IKECGGCPTCP
Equcab AJ312380,IGHG5         (V)VKGSPCPKCP
Equcab AJ312381,IGHG6         (V)IKEPCCCPKCP
Musmus J00453  ,IGHG1         (V)PRDCGCKPCICT
Musmus V00825  ,IGHG2A        (E)PRGPTIKPCPPCKCP
Musmus V00763  ,IGHG2B        (E)PSGPISTINPCPPCKECHKCP
Musmus J00479  ,IGHG2C        (E)PRVPITQNPCPPLKECPPCA
Musmus X00915  ,IGHG3         (E)PRIPKPSTPPGSSCP
Ratnor M28670  ,IGHG1         (V)PRNCGGDCKPCICT
Ratnor M28669  ,IGHG2A        (V)PRECNPCGCT
Ratnor M28671  ,IGHG2B        (E)RRNGGIGHKCPTCPTCHKCP
Ratrat X07189  ,IGHG2C  c     (E)PRRPKPRPPTDICSC
Bostau X16701  ,IGHG1         (D)PTCKPSPCDCCP
Bostau M36946  ,IGHG2         (G)VSSDCSKPNNQH
Bostau U63638  ,IGHG3         (K)SEVEKTPCQCSKCP
Oviari X69797  ,IGHG1   c     (E)PGCPDPCKHCRCPP
Oviari X70983  ,IGHG2   c     (G)ISSDYSKCSKPPC
Susscr AB699686,IGHG1         (G)TKTKPPCPICP
Susscr U03779  ,IGHG2         (G)TKTKPPCPICP
Susscr AB699686,IGHG3         (D)IEPPTPICPEICSCP
Susscr EU372654,IGHG4         (G)TKTKPPCPICP
Susscr AB699686,IGHG5-1       (G)KKTKPRCPICP
Susscr AB699686,IGHG5-2       (G)RPCPICP
Susscr AB699687,IGHG6-1       (G)RPCPICP
Susscr AB699687,IGHG6-2       (G)RPCPICP
Trivul AF157619,IGHG    c     (E)KISECTCCKCQ
Mondom AF035195,IGHG    c     (E)ATTTTCPCCKCNT
Camdro AJ131945,IGHG2         (E)PKIPQPQPKPQPQPQPQPKPQPKPEPECTCPKCP
Camdro Z48947  ,IGHG3   c     (G)TNEVCKCPKC
Orycun L29172  ,IGHG          (A)PSTCSKPTCP
       M
Homsap M60193  ,IGHA1  (G)SCSVADWQMPPPYVVLDLPQETLEEETPGANLWPTTITFLTLFLLSLFYSTALTVTSVRGPSGNREGPQY
Homsap M60194  ,IGHA2  (G)SCCVADWQMPPPYVVLDLPQETLEEETPGANLWPTTITFLTLFLLSLFYSTALTVTSVRGPSGKREGPQY
Musmus K00691  ,IGHA         (E)RQEPLSYVLLDQSQDILEEEAPGASLWPTTVTFLTLFLLSLFYSTALTVTTVRGPFGSKEVPQY
Susscr AB699687,IGHA   (G)PLCLTGHRDPFPWLVLDLLREGPEEETPEASLWPTTVTLLTLFLLSLFYSTALTVTSIRGPADSREGPQY
                                                      M1                      M2
Homsap K02881  ,IGHD        (Y)LAMTPLIPQSKDENSDDYTTFDDVGSLWTTLSTFVALFILTLLYSGIVTFIK VK (K02882)
Musmus J00450  ,IGHD        (G)IVNTIQHSCIMDEQSDSYMDLEEENGLWPTMCTFVALFLLTLLYSGFVTFIK VK
Susscr AB699686,IGHD          (G)LATLTPGSQDEGSDDYVDLEDAGRLWLTFTVLFLVTLLYSGFVTFLK    VK 
Homsap X63693  ,IGHE                    (E)LDVCVEEAEGEAPWTWTGLCIFAALFLLSVSYSAALTLLM VQRFLSATRQGRPQTSLDYTNVLQPHA
Musmus X03624  ,IGHE                (E)LDLQDLCIEEVEGEELEELWTSICVFITLFLLSVSYGATVTVLK VKWVWLSTPMQDTPQTFQDYANILQTRA
Ratnor K02901  ,IGHE	            (E)LDIQDLCTEEVEGEELEELWTSTYIFISLFLLSVSYGATVTVLK VKWVFSTLMHDTPQTFQDYANILQTRA
Susscr AB699687,IGHE                (E)LALEDLCAEEAESQELEAMWTGLLVFTTLFLLSVSYGAAITLCK VKWVLAAILQEQPPASHDYTNVQEPAA
Homsap X52847  ,IGHG1                (E)LQLEESCAEAQDGELDGLWTTITIFITLFLLSVCYSATVTFFK VKWIFSSVVDLKQTIIPDYRNMIGQGA
Homsap AB006775,IGHG2                (E)LQLEESCAEAQDGELDGLWTTITIFITLFLLSVCYSATITFFK VKWIFSSVVDLKQTIVPDYRNMIRQGA (AB006776)
Homsap D78345  ,IGHG3                (E)LQLEESCAEAQDGELDGLWTTITIFITLFLLSVCYSATVTFFK VKWIFSSVVDLKQTIIPDYRNMIGQGA
Macmul AF045538,IGHG3   c (m)        (E)LQLEESCVEAQDGSWTG
Musmus J00454  ,IGHG1                (G)LQLDETCAEAQDGELDGLWTTITIFISLFLLSVCYSAAVTLFK VKWIFSSVVELKQTLVPEYKNMIGQAP
Musmus J00471  ,IGHG2A               (G)LDLDDVCAEAQDGELDGLWTTITIFISLFLLSVCYSASVTLFK VKWIFSSVVELKQTISPDYRNMIGQGA
Musmus J00462  ,IGHG2B               (G)LDLDDICAEAKDGELDGLWTTITIFISLFLLSVCYSASVTLFK VKWIFSSVVELKQKISPDYRNMIGQGA
Musmus X00915  ,IGHG3                (E)LELNETCAEAQDGELDGLWTTITIFISLFLLSVCYSASVTLFK VKWIFSSVVQVKQTAIPDYRNMIGQGA
Camdro AJ131945,IGHG2               (E)PLLEEESCAEAQSGELDGLWTTISIFITLFLLSVCYSATVTLFK VKWIFSSVVELKRTIVPDYRNMIGQGS
Susscr AB699686,IGHG1                (E)LLLEESCADAQDGELDGLWTTISIFITLFLLSVCYSATVTLFK VKWIFSSVVELKRTIVPDYRNMIGQGA
Susscr AB699686,IGHG3                (E)LLLEESCADAQDGELDGLWTTISIFITLFLLSVCYSATVTLFK VKWIFSPVVELKRTIVPDYRNMIGQGA
Susscr AB699686,IGHG5-1              (E)LLLEESCADAQDGELDGLWTTISIFITLFLLSVCYSATVTLFK VKWIFSSVVELKRTIVPDYRNMIGQGA
Susscr AB699686,IGHG5-2              (E)LLLEESCADAQDGELDGLWTTISIFITLFLLSVCYSATVTLFK VKWIFSSVVELKRTIVPDYRNMIGQEA
Susscr AB699687,IGHG6-1              (E)LLLEESCADAQDGELDGLWTTISIFITLFLLSVCYSATVTLFK VKWIFSSVVELKRTIVPDYRNMIGQGA
Susscr AB699687,IGHG6-2              (E)LLLEESCADAQDGELDGLWTTISIFITLFLLSVCYSATVTLFK VKWIFSSVVELKRTIVPDYRNMIGQGA
Homsap X57331  ,IGHM                      (E)GEVSADEEGFENLWATASTFIVLFLLSLFYSTTVTLFK VK
Macmul AF046784,IGHM    c (m)             (E)GEVSADEEGFENLWATASTFIVLFLLSLFYSTTVTLF
Bostau U63637  ,IGHM                      (E)GEVSAEEEGFENLNTMASTFIVLFLLSLFYSTTVTLFK VK
Oviari L04260  ,IGHM    c (m)             (E)GEVSAEEEGFENLNTMASTFIVLFLLSLFYSTTVTLFK VK
Susscr AB699686,IGHM                      (E)GEVSAEEEGFENLNTMASTFIVLFLLSLFYSTTVTLFK VK
0rycun K01357  ,IGHM    c (m)             (E)GEVGAEEEGFENLWTTASTFIVLFLLSLFYSTTVTLFK VK
                                    CONNECTING_REGION    | TRANSMEMBRANE-REGION     | CYTOPLASMIC-REGION

c: cDNA sequence
(m): transcript of a membrane chain

Species:
Bostau: Bos taurus (Bovine)
Camdro: Camelus dromedarius (Camel)
Canfam: Canis lupus familiaris (Dog)
Equcab: Equus caballus (Horse)
Homsap: Homo sapiens (Human)
Macfas: Macaca fascicularis (Crab-eating macaque)
Macmul: Macaca mulatta (Rhesus monkey)
Mondom: Monodelphis domestica (South American short-tailed grey opossum)
Musmus: Mus musculus (house mouse)
Orycun: Oryctolagus cuniculus (Rabbit)
Oviari: Ovis aries (Sheep)
Pantro: Pan troglodytes (Chimpanzee)
Ratnor: Rattus norvegicus (Norway rat)
Ratrat: Rattus rattus (Black rat)
Susscr: Sus scrofa (Pig)
Trivul: Trichosurus vulpecula (common brush-tailed possum)

IMGT notes:
(1) The conserved Cys 104 of the CH1 (IMGT numbering for C-DOMAIN) is replaced by Ser.
(2) Twenty-two additional amino acids are encoded by the 3' end of CH1. As this region is rich in proline (7 aa out of 22), it is likely to be part of the structural hinge [1].
(3) Due to a non conserved ACCEPTOR-SPLICE site (nacnn instead of nagnn) at the beginning of the CH2 exon and to the presence of a cryptic ACCEPTOR-SPLICE 15bp downstream, the five codons of the expected (D)SKFL amino acids are probably not present in cDNAs.
(4)The mouse IGHD gene lacks the CH2 exon but shows a relic sequence just to the right of a (CT)30-(CA)30 repeat in the intron between CH1 and CH3 [2]. The mouse IGHD gene has an additional unusual exon designated as CH-X between the CHS and M1 exons. [3]
(5)The CD strand is 6 amino acid long (45.1 to 45.6) as in the other artiodactyls (Bovidae and Camelidae).

References:
[1] Rabbani , H. et al., Immunogenetics, 46, 326-331 (1997).
[2] Richards, J.E. et al., Nature, 306, 483-487 (1983).
[3] Cheng, H.L. et al., Nature, 296, 410-415 (1982).


Created: 01/10/2002
Authors: Christèle Martinez-Jean and Nathalie Bosc

Software material and data coming from IMGT server may be used for academic research only, provided that it is referred to IMGT®, and cited as "IMGT®, the international ImMunoGeneTics information system® http://www.imgt.org (founder and director: Marie-Paule Lefranc, Montpellier, France)." References to cite: Lefranc, M.-P. et al., Nucleic Acids Res., 27:209-212 (1999); doi: 10.1093/nar/27.1.209 Full text Cover; Ruiz, M. et al., Nucleic Acids Res., 28:219-221 (2000); doi: 10.1093/nar/28.1.219 Full text; Lefranc, M.-P., Nucleic Acids Res., 29:207-209 (2001); doi: 10.1093/nar/29.1.207 Full text; Lefranc, M.-P., Nucleic Acids Res., 31:307-310 (2003); doi: 10.1093/nar/gkg085 Full text; Lefranc, M.-P. et al., In Silico Biol., 5, 0006 (2004) [Epub], 5:45-60 (2005); Lefranc, M.-P. et al., Nucleic Acids Res., 33:D593-597 (2005); doi: 10.1093/nar/gki065 Full text; Lefranc, M.-P. et al., Nucleic Acids Res., 37:D1006-1012 (2009); doi: 10.1093/nar/gkn838 Full text; Lefranc, M.-P. et al., Nucleic Acids Res., 43:D413-422 (2015); doi: 10.1093/nar/gku1056 Full text.
For any other use please contact Marie-Paule Lefranc Marie-Paule.Lefranc@igh.cnrs.fr.

CNRS Université de Montpellier European Commission
IMGT® Founder and Executive Director Emeritus:
Marie-Paule Lefranc Marie-Paule.Lefranc@igh.cnrs.fr
IMGT® Director:
Sofia Kossida Sofia.Kossida@igh.cnrs.fr
Bioinformatics manager:
Véronique Giudicelli Veronique.Giudicelli@igh.cnrs.fr
Computer manager:
Patrice Duroux Patrice.Duroux@igh.cnrs.fr
Webmaster:
Amélie Houles

Citing IMGT | Warranty disclaimer and copyright notice | Privacy policy and advertisement policy

© Copyright 1995-2017 IMGT®, the international ImMunoGeneTics information system®