Protein display: Chimpanzee (Pan troglodytes) IGH C-REGIONs

The IGHC protein display numbering is according to the IMGT unique numbering for C-DOMAIN and C-LIKE-DOMAIN.

Only the *01 allele of each functional, ORF and in-frame pseudogenes C-REGION is shown.

N (Asn, asparagine) of potential N-glycosylation sites (NXS/T, where X is different from P), (N-linked glycosylation) is shown is green (site is underlined in CHS and in pages edited before 14/10/2009).

The hinge exon(s) are shown at the end of the protein display.

_____________________________________________________________________________________________________________________________________________________________________________________________

      IGHC
      genes
_____________________________________________________________________________________________________________________________________________________________________________________________
                                    A        AB     B          BC         C      CD     D          DE           E      EF   F            FG          G
                             -------------->   ---------->             ------>       ------->              ----------->  ------->               ---------->
                             1       10   15  16  20 23      30    36 39 41 45      77     84             85  89     96 97    104    110      118  121    130       140       150
                      7654321|........|....|123|...|...... ...|.....|  |.....|1234567|......|12345677654321|..........|12|....... .....|....... ..|.........|.........|.........|
  CH1
  X53702  ,IGHA1       (A)SPTSPKVFPLSLDSNPQ....DGNVVVACLVQ GFFPQ.EPLS  VTWSESGQGV....TATNFPPSQDASG.....DLYTTSSQLTLPATQC..LAGKSVTC HVKHY...TNPSQ DVTVPCR
  X53706  ,IGHA2       (A)SPTSPKVFPLSLDSNPQ....DGNVVVACLVQ GFFPQ.EPLS  VTWSESGQNV....TATNFPPSQDASG.....DLYTTSSQLTLPATQC..LAGKSVTC HVTHY...TNPSQ DVTVPCR
  M15398  ,IGHE        (A)PTRSPSLFPLTRCCKNIPSN.ATSVTLGCLAM GYFP..EPVM  VTWDAGSLNG....TTMTLPATTLTPS.....GHYATISLLTVSGAW....AKQMFTC RVAHTPSSTDWVD NKTFS
  X65284  ,IGHG1 c     (A)STKGPSVFPLAPSSKSTS...GGTQALGCLVK DYFP..EPVT  VSWNSGALTS....GVHTFPAVLQSS......GLYSLSSVVTVPSSSL...GTQTYIC NVDHKP..SNTKV DKKV
  AF300436,IGHG2                                                                           AVLQSS......GLYSLSSVVAVPSSNF...GTQTYTC NVDHKP..SNTKV DKTV    
  AF300434,IGHG3                                                                           AVLQSS......GLYSLSSVVTVPSSSL...GTQTYIC NVDHKP..SNTKV DKRV    
  AF300432,IGHG4                                                                           AVLQSS......GLYSLSSVVTVPSSSL...GTQTYTC NVDHKP..SNTKV DKTV    
  AF300430,IGHGP                                                                           AVLQSS......GLYSLSSVVTVPSSSL...GTQTYTC NVDHKP..SNTKV DKRV
  CH2 
  X53702  ,IGHA1 (1)       CCHPRLLLHRPALEDLLL..GSEANLTCTLT GLRDA.SGAT  FTWSPSSGKS....AVQGPPERDLCG.......CYSVSSVLPGCAEPW..NHGETFTC TAAYPE..SKTPL TANITKS
  X53706  ,IGHA2 (1)       CCHPRLSLHRPALEDLLL..GSEANLTCTLT GLRDA.SGAT  FTWTPPSGKS....AVQGPPERDLCG.......CYSVSSVLPGCAQPW..NHGETFTC TAAHPE..LKNPL TANITKS
  M15398  ,IGHE	     (V)CSRDFTPTVKVLQSSCDGGGHF.PPTIQLLCLVS GYTP..GTIN  ITWLEDGQVMD...VDLSTASATQEG......ELASTQSELTLSQKHW..LSDRTYTC QVTYQ....GGTF EDSTKKCA
  X61311  ,IGHG1 c   (A)PELLGGPSVFLFPPKPKDTLMI.SRTPEVTCVVV DVSHEDPEVK  FNWYVDGVEVH...NAKTKPREEQYN......STYRVVSVLTVLHQDW..LNGKEYKC KVSNKA..LPAPI EKTISKAK
  AF300436,IGHG2      (A)LPVAGPSVFLFPPKPKDTLMI.SRTPEVTC
  AF300434,IGHG3     (A)PELLGGPSVFLFPPKPKDTLMI.TRTPEVTC
  AF300432,IGHG4     (A)PEFLGGPSVFLFPPKPKDTLMI.SRTPEVTC
  AF300430,IGHGP     (A)PELLGGPSVFLFPPKPKDTLMI.SRTPEVTC 
  CH3
  X53702  ,IGHA1       (G)NTFRPEVHLLPPPSEELAL..NELVTLTCLAR GFSP..KDVL  VRWLQGSQELPRE.KYLTWASRQEPSQG...TTTFAVTSILRVAAEDW..KKGDTFSC MVGHEA.LPLAFT QKTIDRLA...GKPTHVNVSVVMAEVDGTCY
  X53706  ,IGHA2       (G)NTFRPEVHLLPPPSEELAL..NELVTLTCLAR GFSP..KDVL  VRWLQGSQELPRE.KYLTWASRQEPSQG...TTTYAVTSILRVAAEDW..KKGDTFSC MVGHEA.LPLAFT QKTIDRLA...GKPTHINVSVVMAEVDGTCY
  M15398  ,IGHE	      (D)SNPRGVSAYLSRPSPFDLFI..RKSPTITCLVV DLAPSKGTVN  LTWSRASGKPV...NHSTRKQEKQRN......GTLTVTSTLPVGTRDW..IEGETYQC RVTHPH..LPRAL VRSTTKTS
  X61310  ,IGHG1 c     (G)QPREPQVYTLPPSRDELT...KNQVSLTCLVK GFYP..SDIA  VEWESSGQPEN...NYKTTPPVLDSD......GSFFLYSKLTVDKSRW..QQGNVFSC SVMHEA.LHNHYT QKS
  CH4
  M15398  ,IGHE        (G)PRAAPEVYAFATPEGPGS...RDKRTLACLIQ NFMP..EDIS  VQWLHNEVQLPDA.RHSTTQPHKTKG......SGFFVFSRLEVTRAEW..EQKDEFIC RAVHEAASPSQTV QRTVSVNP...GK
  Hinge 
  X53702  ,IGHA1	(V)PSTPCPPTPSTPPTPSPS
  X53706  ,IGHA2	(V)PPPPP
  X65285  ,IGHG1  c	(E)PKSCDTTHTCPPCA
  AF300436,IGHG2           (E)RKCCVECPPCP
  AF300434,IGHG3 [H1] (E)LKTPLGDTTHTCPRCP    [H2] (E)PKSCDTPPPCPRCP 
  AF300432,IGHG4           (E)SKYGPQCPSCP      
  AF300430,IGHGP      (E)PKTPCCDTTHTCPPCA

c: cDNA sequence

IMGT note:
(1) In the IGHA gene, the hinge (H) and CH2 are joined in a single exon.


Created: 12/11/2002
Author: Nathalie Bosc

Software material and data coming from IMGT server may be used for academic research only, provided that it is referred to IMGT®, and cited as "IMGT®, the international ImMunoGeneTics information system® http://www.imgt.org (founder and director: Marie-Paule Lefranc, Montpellier, France)." References to cite: Lefranc, M.-P. et al., Nucleic Acids Res., 27:209-212 (1999); doi: 10.1093/nar/27.1.209 Full text Cover; Ruiz, M. et al., Nucleic Acids Res., 28:219-221 (2000); doi: 10.1093/nar/28.1.219 Full text; Lefranc, M.-P., Nucleic Acids Res., 29:207-209 (2001); doi: 10.1093/nar/29.1.207 Full text; Lefranc, M.-P., Nucleic Acids Res., 31:307-310 (2003); doi: 10.1093/nar/gkg085 Full text; Lefranc, M.-P. et al., In Silico Biol., 5, 0006 (2004) [Epub], 5:45-60 (2005); Lefranc, M.-P. et al., Nucleic Acids Res., 33:D593-597 (2005); doi: 10.1093/nar/gki065 Full text; Lefranc, M.-P. et al., Nucleic Acids Res., 37:D1006-1012 (2009); doi: 10.1093/nar/gkn838 Full text; Lefranc, M.-P. et al., Nucleic Acids Res., 43:D413-422 (2015); doi: 10.1093/nar/gku1056 Full text.
For any other use please contact Marie-Paule Lefranc Marie-Paule.Lefranc@igh.cnrs.fr.

CNRS Université de Montpellier European Commission
IMGT® Founder and Executive Director Emeritus:
Marie-Paule Lefranc Marie-Paule.Lefranc@igh.cnrs.fr
IMGT® Director:
Sofia Kossida Sofia.Kossida@igh.cnrs.fr
Bioinformatics manager:
Véronique Giudicelli Veronique.Giudicelli@igh.cnrs.fr
Computer manager:
Patrice Duroux Patrice.Duroux@igh.cnrs.fr
Webmaster:
Amélie Houles

Citing IMGT | Warranty disclaimer and copyright notice | Privacy policy and advertisement policy

© Copyright 1995-2017 IMGT®, the international ImMunoGeneTics information system®