Protein display: Dog (Canis lupus familiaris) IGH C-REGIONs

The IGHC protein display numbering is according to the IMGT unique numbering for C-DOMAIN and C-LIKE-DOMAIN.

Only the *01 allele of each functional, ORF and in-frame pseudogenes C-REGION is shown.

N (Asn, asparagine) of potential N-glycosylation sites (NXS/T, where X is different from P), (N-linked glycosylation) is shown is green (site is underlined in CHS and in pages edited before 14/10/2009).

The hinge exon(s) are shown at the end of the protein display.

_____________________________________________________________________________________________________________________________________________________________________________________________

      IGHC
      genes
_____________________________________________________________________________________________________________________________________________________________________________________________
                                         A        AB     B          BC         C      CD     D          DE           E      EF   F            FG          G             CHS
                                  -------------->   ---------->             ------>       ------->              ----------->  ------->               ---------->
                                  1       10   15  16  20 23      30    36 39 41 45      77     84             85  89     96 97    104    110      118  121    130       140       150
                           7654321|........|....|123|...|...... ...|.....|  |.....|1234567|......|12345677654321|..........|12|....... .....|....... ..|.........|.........|.........|
  CH1
  AAEX03006125  ,IGHA       (E)SKTSPSVFPLSLCHQES....EGYVVIGCLVQ GFFPP.EPVN  VTWNAGKDST....SVKNFPPMKAATG.....SLYTMSSQLTLPAAQC..PDDSSVKC QVQHA...SSPSK AVSVPCK
  AAEX03006125  ,IGHE       (A)TSQDLSVFPLASCCKDNIA..STSVTLGCLVT GYLP..MSTT  VTWDTGSLNK....NVTTFPTTFHETY.....GLHSIVSQVTASGEW....AKQRFTC SVAHA...ESTAI NKTFS
  AF354264      ,IGHG1 c    (A)STTAPSVFPLAPSCGSTS...GSTVALACLVS GYFP..EPVT  VSWNSGSLTS....GVHTFPSVLQSS......GLHSLSSMVTVPSSRW...PSETFTC NVVHPA..SNTKV DKP
  AAEX03006126  ,IGHG2      (A)STTAPSVFPLAPSCGSTS...GSTVALACLVS GYFP..EPVT  VSWNSGSLTS....GVHTFPSVLQSS......GLYSLSSMVTVPSSRW...PSETFTC NVAHPA..SKTKV DKP
  AF354266      ,IGHG3 c    (A)STTAPSVFPLAPSCGSQS...GSTVALACLVS GYIP..EPVT  VSWNSVSLTS....GVHTFPSVLQSS......GLYSLSSMVTVPSSRW...PSETFTC NVAHPA..TNTKV DKP
  AF354267      ,IGHG4 c    (A)STTAPSVFPLAPSCGSTS...GSTVALACLVS GYFP..EPVT  VSWNSGSLTS....GVHTFPSVLQSS......GLYSLSSTVTVPSSRW...PSETFTC NVVHPA..SNTKV DKP
  AAEX03006126  ,IGHM       (G)SPSPPNLFPLITCENSLSD..ETLVAMGCLAR DFLP..GSIT  FSWKYENLSAIN..NQDIKTFPSVLRE.....GKYVATSQVFLPSVDIIQGSDEYITC NVKHS....NGDK SVNVPIT
  CH2
  AAEX03006125  ,IGHA (1)       CNEPRLSLQKPALEDLLL..GSNASLTCTLS GLKDP.KGAT  FTWNPSKGKE....PIQKNPERDSCG.......CYSVSSVLPGCADPW..NHGDTFSC TATHPE..SKSPI TVSITKTT
  AAEX03006125  ,IGHE    (A)CALNFIPPTVKLFHSSCNPVGDT.HTTIQLLCLIS GYVP..GDME  VIWLVDGQKATN..IFPYTAPGTKEG......NVTSTHSELNITQGEW..VSQKTYTC QVTYQ....GFTF KDEARKCS
  AF354264      ,IGHG1 c  (V)PEPLGGPSVLIFPPKPKDILRI.TRTPEVTCVVL DLGREDPEVQ  ISWFVDGKEVH...TAKTQSREQQFN......GTYRVVSVLPIEHQDW..LTGKEFKC RVNHID..LPSPI ERTISKAR
  AAEX03006126  ,IGHG2    (A)PEMLGGPSVFIFPPKPKDTLLI.ARTPEVTCVVV DLDPEDPEVQ  ISWFVDGKQMQ...TAKTQPREEQFN......GTYRVVSVLPIGHQDW..LKGKQFTC KVNNKA..LPSPI ERTISKAR
  AF354266      ,IGHG3 c  (G)CGLLGGPSVFIFPPKPKDILVT.ARTPTVTCVVV DLDPENPEVQ  ISWFVDSKQVQ...TANTQPREEQSN......GTYRVVSVLPIGHQDW..LSGKQFKC KVNNKA..LPSPI EEIISKTP
  AF354267      ,IGHG4 c  (V)PESLGGPSVFIFPPKPKDILRI.TRTPEITCVVL DLGREDPEVQ  ISWFVDGKEVH...TAKTQPREQQFN......STYRVVSVLPIEHQDW..LTGKEFKC RVNHIG..LPSPI ERTISKAR
  AAEX03006126  ,IGHM      (G)PVPTSPNVTVFIPPRDAFSGNGQRKSQLICQAA GFSP..KQIS  VSWFRDGKQIES..GFNTGKAEAEEKEH..GPVTYSILSMLTITESAW..LSQSVFTC HVEHN....GIIF QKNVSSMCTS
  CH3
  AAEX03006125  ,IGHA        (E)HIPPQVHLLPPPSEELAL..NELVTLTCLVR GFKP..KDVL  VRWLQGTQELPQE.KYLTWEPLKEPDQ....TNMFAVTSMLRVTAEDW..KQGEKFSC MVGHEA.LPMSFT QKTIDRLA...GKPTHVNVSVVMAEVDGICY
  AAEX03006125  ,IGHE      (E)SDPRGVSSYLSPPSPLDLYV..HKAPKITCLVV DLATM.EGMN  LTWYRESKEPV...NPGPLNKKDHFN......GTITVTSTLPVNTNDW..IEGETYYC RVTHPH..LPKDI VRSIAKAP
  AF354264      ,IGHG1 c    (G)RAHKPSVYVLPPSPKELSS..SDTVSITCLIK DFYP..PDID  VEWQSNGQQEPER.KHRMTPPQLDED......GSYFLYSKLSVDKSRW..QQGDPFTC AVMHET.LQNHYT DLSLSHSP...GK
  AAEX03006126  ,IGHG2      (G)QAHQPSVYVLPPSREELS...KNTVSLTCLIK DFFP..PDID  VEWQSNGQQEPES.KYRTTPPQLDED......GSYFLYSKLSVDKSRW..QRGDTFIC AVMHEA.LHNHYT QKSLSHSP...GK
  AF354266      ,IGHG3 c    (G)QAHQPNVYVLPPSRDEMS...KNTVTLTCLVK DFFP..PEID  VEWQSNGQQEPES.KYRMTPPQLDED......GSYFLYSKLSVDKSRW..QRGDTFIC AVMHEA.LHNHYT QISLSHSP...GK
  AF354267      ,IGHG4 c    (G)QAHQPSVYVLPPSPKELSS..SDTVTLTCLIK DFFP..PEID  VEWQSNGQPEPES.KYHTTAPQLDED......GSYFLYSKLSVDKSRW..QQGDTFTC AVMHEA.LQNHYT DLSLSHSP...GK
  AAEX03006126  ,IGHM       (N)TPVGISIFTIPPSFASIFN..TKSAKLSCLVT DLATY.DSLT  ISWTRQNGEAL...KTHTNISESHPN......NTFSAMGEATVCVEEW..ESGEQFTC TVTHTD..LPSPL KKTISRPK
  CH4
  AAEX03006125  ,IGHE       (G)KRAPPDVYLFLPPEEEQGT..KDRVTLTCLIQ NFFP..ADIS  VQWLRNDSPIQTD.QYTTTGPHKVSGS....RPAFFIFSRLEVSRVDW..EQKNKFTC QVVHEALSGSRIL QKWVSKTP...GK
  AAEX03006126  ,IGHM      (D)VNKHMPSVYVLPPSREQLSL..RESASLTCLVK GFSP..PDVF  VQWLQKGQPVPPD.SYVTSAPMPEPQA....PGLYFVHSILTVSEEDW..NAGETYTC VVGHEA.LPHVVT ERSVDKST...GKPTLYNVSLVLSDTASTCY
  M
  AAEX03006125  ,IGHA  (D)SQCLAGYREPLPWLVLDLSQEDLEEDAPGASLWPTTVTLLTLFLLSLFYSTALTVTSVRGPTDSREGPQY
                                                     M1                        M2
  AAEX03006125  ,IGHE           (E)LQELCADATESEELDELWASLLIFITLFLLSVSYGATSTLFK  VKWVLATVLQEKPQAAQDYANIVRPAQ
  AAEX03006126 ,IGHG2          (E)LILDDSCAEDQDGELDGLWTTISIFITLFLLSVCYSATVTLFK  VKWIFSSVVELKRTIVPDYRNMIGQGA 
  AAEX03006126  ,IGHM               (G)GEVSAEEEGFENLNTMASTFIVLFLLSVFYSTTVTLFK  VK
                              CONNECTING-REGION    | TRANSMEMBRANE-REGION      | CYTOPLASMIC-REGION
  Hinge
  AAEX03006125  ,IGHA (1)    (D)NCHPCPHPSPS
  AF354264      ,IGHG1 c     (V)FNECRCTDTPPCP
  AAEX03006126  ,IGHG2       (V)PKRENGRVPRPPDCPKCP
  AF354266      ,IGHG3 c     (V)AKECECKCNCNNCPCP
  AF354267      ,IGHG4 c     (V)PKESTCKCISPCP

c: cDNA sequence

IMGT note:

(1) In the IGHA gene, the hinge (H) and CH2 are joined in a single exon.


Created: 22/10/2002
Author:Saida Hadi-Saljoqi, Nathalie Bosc

Software material and data coming from IMGT server may be used for academic research only, provided that it is referred to IMGT®, and cited as "IMGT®, the international ImMunoGeneTics information system® http://www.imgt.org (founder and director: Marie-Paule Lefranc, Montpellier, France)." References to cite: Lefranc, M.-P. et al., Nucleic Acids Res., 27:209-212 (1999); doi: 10.1093/nar/27.1.209 Full text Cover; Ruiz, M. et al., Nucleic Acids Res., 28:219-221 (2000); doi: 10.1093/nar/28.1.219 Full text; Lefranc, M.-P., Nucleic Acids Res., 29:207-209 (2001); doi: 10.1093/nar/29.1.207 Full text; Lefranc, M.-P., Nucleic Acids Res., 31:307-310 (2003); doi: 10.1093/nar/gkg085 Full text; Lefranc, M.-P. et al., In Silico Biol., 5, 0006 (2004) [Epub], 5:45-60 (2005); Lefranc, M.-P. et al., Nucleic Acids Res., 33:D593-597 (2005); doi: 10.1093/nar/gki065 Full text; Lefranc, M.-P. et al., Nucleic Acids Res., 37:D1006-1012 (2009); doi: 10.1093/nar/gkn838 Full text; Lefranc, M.-P. et al., Nucleic Acids Res., 43:D413-422 (2015); doi: 10.1093/nar/gku1056 Full text.
For any other use please contact Marie-Paule Lefranc Marie-Paule.Lefranc@igh.cnrs.fr.

CNRS Université de Montpellier European Commission
IMGT® Founder and Executive Director Emeritus:
Marie-Paule Lefranc Marie-Paule.Lefranc@igh.cnrs.fr
IMGT® Director:
Sofia Kossida Sofia.Kossida@igh.cnrs.fr
Bioinformatics manager:
Véronique Giudicelli Veronique.Giudicelli@igh.cnrs.fr
Computer manager:
Patrice Duroux Patrice.Duroux@igh.cnrs.fr
Webmaster:
Amélie Houles

Citing IMGT | Warranty disclaimer and copyright notice | Privacy policy and advertisement policy

© Copyright 1995-2017 IMGT®, the international ImMunoGeneTics information system®