Protein display: Horse (Equus caballus) IGH C-REGIONs

The IGHC protein display numbering is according to the IMGT unique numbering for C-DOMAIN and C-LIKE-DOMAIN.

Letters in red correspond to amino acids which are polymorphic in the other alleles.
For C-REGIONs, letters in bold correspond to additional positions in the IMGT unique numbering.
For C-REGIONs, letters between parentheses correspond to amino acids resulting from the splicing.

N (Asn, asparagine) of potential N-glycosylation sites (NXS/T, where X is different from P), (N-linked glycosylation) is shown is green (site is underlined in CHS and in pages edited before 14/10/2009).

The hinge exon(s) are shown at the end of the protein display.

_____________________________________________________________________________________________________________________________________________________________________________________________

      IGHC
      genes
_____________________________________________________________________________________________________________________________________________________________________________________________
                                  A        AB     B          BC         C      CD     D          DE           E      EF   F            FG          G             CHS
                           -------------->   ---------->             ------>       ------->              ----------->  ------->               ---------->
                           1       10   15  16  20 23      30    36 39 41 45      77     84             85  89     96 97    104    110      118  121    130       140       150
                    7654321|........|....|123|...|...... ...|.....|  |.....|1234567|......|12345677654321|..........|12|....... .....|....... ..|.........|.........|.........|

  CH1
  AJ305046,IGHE      (V)SKQAPLILPLAACCKDTK...TTNITLGCLVK GYFP..EPVT  VTWDAGSLNR....STMTFPAVFDQTS.....GLYTTISRVVASGKW....AKQKFTC NVVHS....QETF NKTFN
  AJ302055,IGHG1     (A)STTAPKVFALAPGCGTTS...DSTVALGCLVS GYFP..EPVK  VSWNSGSLTS....GVHTFPSVLQSS......GFYSLSSMVTVPASSW...TSETYIC NVVHAA..SNFKV DKRI
  AJ302056,IGHG2     (A)STTAPKYFQLTPSCGITS...DATVALGCLVS DYYP..EPVT  VSWNSGALTS....GVHTFPSVLQSS......GLYALSSMVTVPASTW...TSETYIC NVAHPA..SSTKV DKRI
  AJ312379,IGHG3     (A)STTAPKVFPLAPSCGTTS...DSTVALGCLVS SYFP..EPVT  VSWNSGTLTS....GVRTFPSVLQSS......GLYSLSSMVTVPASSL...ESKTYIC NVAHPA..SSTKV DKRI
  AJ302058,IGHG4     (A)STTAPKVFPLASHSAATS...GSTVALGCLVS SYFP..EPVT  VSWNSGALTS....GVHTFPSVLQSS......GLYSLSSMVTVPASSL...KSQTYIC NVAHPA..SSTKV DKKI
  AJ312380,IGHG5     (E)SPKAPDVFPLTICGNTP....DPTVPVGCLVS NYFP..EPVT  VSWNCDALKG....DIHTFPLDLSNS......AHHSLSSMVAVPRSS....LNQTYIC SVAHPA..SSTKV DKRI
  AJ312381,IGHG6     (A)STTAPKVFQLASHSAGTS...DSTVALGCLVS SYFP..EPVT  VSWNSGALTS....GVHTFPSVRQSS......GLYSLSSMVTVPASSL...KSQTYIC NVAHPA..SSTKV DKRI
  L49414  ,IGHM c    (E)STKTPDLFPLVSCGPSLD...ESLVAVGCLAR DFLP..NVIT  FSLELPEQHCSQYPGHHEFPSVLREG.......KYSASSQVLLPSG......DVPLVC TVNHS....NGNE KVEVRPQ
  CH2
  AJ305046,IGHE   (A)CIVTFTPPTVKLFHSSCDPGGDS.HTTIQLLCLIS DYTP..GDID  IVWLIDGQKVDE..QFPQHGLVKQEG......KLASTHSELNITQGQW..ASENTYTC QVTYK....DMIF KDQARKCT
  AJ302055,IGHG1   (A)PELLGGPSVFIFPPNPKDTLMI.TRTPEVTCVVV DVSQENPDVK  FNWYMDGVEVR...TATTRPKEEQFN......STYRVVSVLRIQHQDW..LSGKEFKC KVNNQA..LPQPI ERTITKTK
  AJ302056,IGHG2        (G)GPSVFIFPPNPKDALMI.SRTPVVTCVVV NLSDQYPDVQ  FSWYVDNTEVH...SAITKQREAQFN......STYRVVSVLPIQHQDW..LSGKEFKC SVTNVG..VPQPI SRAISRGK
  AJ312379,IGHG3   (A)PELLGGPSVFIFPPKPKDVLMI.TRTPEVTCLVV DVSHDSSDVL  FTWYVDGTEVK...TAKTMPNEEQNN......STYRVVSVLRIQHQDW..LNGKKFKC KVNNQA..LPAPV ERTISKAT
  AJ302058,IGHG4    (E)CLSVGPSVFIFPPKPKDVLMI.SRTPTVTCVVV DVGHDFPDVQ  FNWYVDGVETH...TATTEPKQEQNN......STYRVVSILAIQHKDW..LSGKEFKC KVNNQA..LPAPV QKTISKPT
  AJ312380,IGHG5   (A)PELPGGPSVFIFPPKPKDVLKI.SRKPEVTCVVV DLGHDDPDVQ  FTWFVDGVETH...TATTEPKEEQFN......STYRVVSVLPIQHQDW..LSGKEFKC SVTNKA..LPAPV ERTTSKAK
  AJ312381,IGHG6   (D)SKFLGRPSVFIFPPNPKDTLMI.SRTPEVTCVVV DVSQENPDVK  FNWYVDGVEAH...TATTKAKEKQDN......STYRVVSVLPIQHQDW..RRGKEFKC KVNNRA..LPAPV ERTITKAK
  L49414  ,IGHM c  (V)LIQDESPNVTVFIPPRDAFTGPGQRTSRLVCQAT GFSP..KEIS  VSWLRDGKPVES..GFTTEEVQPQNKES..WPVTYKVTSMLTITESDW..LNQKVFTC HVEHT....GGSF QKNVSSMCSP
  CH3
  AJ305046,IGHE     (E)SDPRGVSVYLSPPSPLDLYV..SKSPKITCLVV DLANV.QGLS  LNWSRESGEPL...QKHTLATSEQFN......KTFSVTSTLPVDTTDW..IEGETYKC TVSHPD..LPREV VRSIAKAP
  AJ302055,IGHG1     (G)RSQEPQVYVLAPHPDEDS...KSKVSVTCLVK DFYP..PEIN  IEWQSNGQPELET.KYSTTQAQQDSD......GSYFLYSKLSVDRNRW..QQGTTFTC GVMHEA.LHNHYT QKNVSKNP...GK
  AJ302056,IGHG2     (G)PSRVPQVYVLPPHPDELA...KSKVSVTCLVK DFYP..PDIS  VEWQSNRWPELEG.KYSTTPAQLDGD......GSYFLYSKLSLETSRW..QQVESFTC AVMHEA.LHNHFT KTDISESL...GK
  AJ312379,IGHG3     (G)QTRVPQVYVLAPHPDELS...KNKVSVTCLVK DFLP..TDIT  VEWQSNEHPEPEG.KYRTTEAQKDSD......GSYFLYSKLTVETDRW..QQGTTFTC VVMHEA.LHNHVM QKNVSHSP...GK
  AJ302058,IGHG4     (G)QPREPQVYVLAPHRAELS...KNK?SVTCLVK DFYP..TDID  IEWKSNGQPEPET.KYSTTPAQLDSD......GSYFLYSKLTVETNRW..QQGTTFTC AVMHEA.LHNHYT EKSVSKSP...GK
  AJ312380,IGHG5     (G)QLRVPQVYVLAPHPDELA...KNTVSVTCLVK DFYP..PEID  VEWQSNEHPEPEG.KYSTTPAQLNSD......GSYFLYSKLSVETSRW..KQGESFTC GVMHEA.VENHYT QKNVSHSP...GK
  AJ312381,IGHG6     (G)ELQDPKVYILAPHREEVT...KNTVSVTCLVK DFYP..PDIN  VEWQSNEEPEPEV.KYSTTPAQLDGD......GSYFLYSKLTVETDRW..EQGESFTC VVMHEA.IRHTYR QKSITNFP...GK
  L49414  ,IGHM c    (I)HQSPIQIFAIPPSFAGIFL..TKSAKLSCQVT NLGTY.DSLS  ISWTRQNGEIL...KTHTNISESHPN......GTFSALGEATICVEDW..ESGDDYIC TVTHTD..LPFPL KQVISRPD
  CH4
  AJ305046,IGHE      (G)KRLSPEVYVFLPPEEDQSS..KDKVTLTCLIQ NFFP..ADIS  VQWLRNNVLIQTD.QQATTRPQKANGP....NPAFFVFSRLEVSRAEW..EQKNKFAC KVVHEA.LSQRTL QKEVSKDP...GK
  L49414  ,IGHM c   (A)VGKHPPSVYVLPPHREQLSL..RESASITCLVK GFLTP.PDVS  VQWLQEGQPLSPD.KYVTSAPMLDPSP....QALYFVHSILTVSEEDW..SSGETYTC VVGHEA.LPHVVT ERTVDKSH...CKPTLYNVSLVMSDMASTCYCKPTLYNVSLVMSDMASTCY
  Hinge
  AJ302055,IGHG1       (E)PIPDNHQKVCDMSKCPKCP
  AJ302056,IGHG2       (A)RVTPVCSLCRGRYPHPI
  AJ312379,IGHG3       (E)PVLPKPTTPAPTVPLTTTVPVETTTPPCPCECPKCP
  AJ302058,IGHG4       (V)IKECGGCPTCP
  AJ312380,IGHG5       (V)VKGSPCPKCP
  AJ312381,IGHG6       (V)IKEPCCCPKCP
  

c: cDNA sequence


Created: 10/06/2002
Last updated: Friday, 27-May-2016 21:03:30 CEST
Author: Delphine Guiraudou

Software material and data coming from IMGT server may be used for academic research only, provided that it is referred to IMGT®, and cited as "IMGT®, the international ImMunoGeneTics information system® http://www.imgt.org (founder and director: Marie-Paule Lefranc, Montpellier, France)." References to cite: Lefranc, M.-P. et al., Nucleic Acids Res., 27:209-212 (1999); doi: 10.1093/nar/27.1.209 Full text Cover; Ruiz, M. et al., Nucleic Acids Res., 28:219-221 (2000); doi: 10.1093/nar/28.1.219 Full text; Lefranc, M.-P., Nucleic Acids Res., 29:207-209 (2001); doi: 10.1093/nar/29.1.207 Full text; Lefranc, M.-P., Nucleic Acids Res., 31:307-310 (2003); doi: 10.1093/nar/gkg085 Full text; Lefranc, M.-P. et al., In Silico Biol., 5, 0006 (2004) [Epub], 5:45-60 (2005); Lefranc, M.-P. et al., Nucleic Acids Res., 33:D593-597 (2005); doi: 10.1093/nar/gki065 Full text; Lefranc, M.-P. et al., Nucleic Acids Res., 37:D1006-1012 (2009); doi: 10.1093/nar/gkn838 Full text; Lefranc, M.-P. et al., Nucleic Acids Res., 43:D413-422 (2015); doi: 10.1093/nar/gku1056 Full text.
For any other use please contact Marie-Paule Lefranc Marie-Paule.Lefranc@igh.cnrs.fr.

CNRS Université de Montpellier European Commission
IMGT® Founder and Executive Director Emeritus:
Marie-Paule Lefranc Marie-Paule.Lefranc@igh.cnrs.fr
IMGT® Director:
Sofia Kossida Sofia.Kossida@igh.cnrs.fr
Bioinformatics manager:
Véronique Giudicelli Veronique.Giudicelli@igh.cnrs.fr
Computer manager:
Patrice Duroux Patrice.Duroux@igh.cnrs.fr
Webmaster:
Amélie Houles

Citing IMGT | Warranty disclaimer and copyright notice | Privacy policy and advertisement policy

© Copyright 1995-2017 IMGT®, the international ImMunoGeneTics information system®