Protein display: Human TRA, TRB, TRG and TRD C-REGIONs

The TRC protein display numbering is according to the IMGT unique numbering for C-DOMAIN and C-LIKE-DOMAIN.

Letters in red correspond to amino acids which are polymorphic in the other alleles.
For C-REGIONs, letters in bold correspond to additional positions in the IMGT unique numbering.
For C-REGIONs, letters between parentheses correspond to amino acids resulting from the splicing.

N (Asn, asparagine) of potential N-glycosylation sites (NXS/T, where X is different from P), (N-linked glycosylation) is shown is green (site is underlined in CHS and in pages edited before 14/10/2009).

The TRA, TRB, TRG and TRD protein display numbering is according to the IMGT unique numbering for C-DOMAIN and C-LIKE-DOMAIN.

_____________________________________________________________________________________________________________________________________________________________________________________________

      TR C-GENEs

_____________________________________________________________________________________________________________________________________________________________________________________________
                                    A        AB     B           BC        C      CD      D          DE           E      EF   F                FG                    G  
                              -------------->   ---------->             ------>       ------->              ----------->  ------->                           ---------------->
                              1       10   15  16  20 23 26   30    36 39 41 45      77     84             85  89     96 97    104    110              115 118  121    130
                      87654321|........|....|123|...|...... ...|.....|  |.....|1234567|......|12345677654321|..........|12|....... .....|.123456654321...|.. ..|.........|....
 EX1
  X02883  ,TRAC  (1)   (N)IQNPDPAVYQLRDSK........SSDKSVCLFT DFDS...QTN  VSQSKDS.......DVYITDKTVLDMRSM.DFKSNSAVAWSNKS..........DFAC ANAFNN..............SIIPE DTFFPSP
  M12887  ,TRBC1     (E)DLNKVFPPEVAVFEPSEAEISH..TQKATLVCLAT GFFP..DHVE  LSWWVNGKEVHS..GVSTDPQPLKEQPAL.NDSRYCLSSRLRVSATFWQ.NPRNHFRC QVQFYGLSENDEWTQDRAKPVTQIV SAEAWGRA
  M12888  ,TRBC2     (E)DLKNVFPPEVAVFEPSEAEISH..TQKATLVCLAT GFYP..DHVE  LSWWVNGKEVHS..GVSTDPQPLKEQPAL.NDSRYCLSSRLRVSATFWQ.NPRNHFRC QVQFYGLSENDEWTQDRAKPVTQIV SAEAWGRA
  M22148  ,TRDC       (R)SQPHTKPSVFVMKNG...........TNVACLVK EFYP..KDIR  INLVSSKKI.....TEFDPAIVISPS......GKYNAVKLGKYED.......SNSVTC SVQHDN.............KTVHST DFEVKTDST
  M14996  ,TRGC1    (D)KQLDADVSPKPTIFLPSIAETKL..QKAGTYLCLLE KFFP..DVIK  IHWQEKKSNTIL..GSQEGNTMKTND.......TYMKFSWLTVPEK....SLDKEHRC IVRHENN............KNGVDQ EIIFPPIKT
  M15002  ,TRGC2(2x)(D)KQLDADVSPKPTIFLPSIAETKL..QKAGTYLCLLE KFFP..DIIK  IHWQEKKSNTIL..GSQEGNTMKTND.......TYMKFSWLTVPEE....SLDKEHRC IVRHENN............KNGIDQ EIIFPPIKT
c M17323  ,TRGC2(3x)(D)KQLDADVSPKPTIFLPSIAETKL..QKAGTYLCLLE KFFP..DIIK  IHWQEKKSNTIL..GSQEGNTMKTND.......TYMKFSWLTVPEE....SLDKEHRC IVRHENN............KNGIDQ EIIFPPIKT

                                                 CONNECTING-REGION
                         [EX2T]                [EX2R]                                      [EX2]                    
  X02883  ,TRAC                                                                         (E)SSCDVKLVEKSFET      
  M12887  ,TRBC1                                                                          (D)CGFTS               
  M12888  ,TRBC2                                                                          (D)CGFTS               
  M22149  ,TRDC                                                           (D)HVKPKETENTKQPSKSCHKPK   
  M14997  ,TRGC1                                                                 (D)VITMDPKDNCSKDAN  
c M13231  ,TRGC2*01(2x) (D)VTTVDPKDSYSKDAN                                       (D)VITMDPKDNWSKDAN
  M15004  ,TRGC2*02(2x)                     (D)VTTVDPKYNYSKDAN          (M15005) (D)VITMDPKDNWSKDAN
c M17323  ,TRGC2*05(3x) (D)VTTVDPKDSYSKDAN  (D)VTTVDPKYNYSKDAN                   (D)VITMDPKDNWSKDAN          

                               TRANSMEMBRANE-REGION    CYTOPLASMIC-REGION
                            [EX3]                           [EX4]
  X02883  ,TRAC         (D)TNLNFQNLSVIGFRILLLKVAGFNLLMTLRLWSS					  
  M12887  ,TRBC1        (V)SYQQGVLSATILYEILLGKATLYAVLVSALVLMAM  VKRKDF	
  M12888  ,TRBC2        (E)SYQQGVLSATILYEILLGKATLYAVLVSALVLMAM  VKRKDSRG
  M22150  ,TRDC          (A)IVHTEKVNMMSLTVLGLRMLFAKTVAVNFLLTAKLFFL
  M14998  ,TRGC1       (D)TLLLQLTNTSAYYMYLLLLLKSVVYFAIITCCLLRRTAFCCNGEKS
c M13231  ,TRGC2*01(2x)(D)TLLLQLTNTSAYYMYLLLLLKSVVYFAIITCCLLGRTAFCCNGEKS		  
  M15007  ,TRGC2*02(2x)(D)TLLLQLTNTSAYYMYLLLLLKSVVYFAIITCCLLGRTAFCCNGEKS
c M17323  ,TRGC2*05(3x)(D)TLLLQLTNTSAYYMYLLLLLKSVVYFAIITCCLLGRTAFCCNGEKS
c M27332  ,TRGC2*08(2x)(D)TLL.QLTNTSAYYMYLLLLLKSVVYFAIITCCLLGRTAFCCNGEKS
c: cDNA

IMGT note:
(1) The first amino acid of the TRA C-REGION which results from the splicing with the J-REGION is N (codon aat), D (codon gat), Y (codon tat) or H (codon cat) for 35, 12, 7 and 4 TRAJ, respectively. See Alignment of alleles: Human TRAJ (overview) for the sequences of the 58 FUNCTIONAL and ORF TRA J-REGION.


Created: 14/09/2001
Last updated: Friday, 08-Jul-2011 13:53:56 CEST
Author: Christèle Martinez-Jean and joumana Jabado-Michaloud
Contact:
Marie-Paule Lefranc

Software material and data coming from IMGT server may be used for academic research only, provided that it is referred to IMGT®, and cited as "IMGT®, the international ImMunoGeneTics information system® http://www.imgt.org (founder and director: Marie-Paule Lefranc, Montpellier, France)." References to cite: Lefranc, M.-P. et al., Nucleic Acids Research, 27, 209-212 (1999) Cover of NAR; Ruiz, M. et al., Nucleic Acids Research, 28, 219-221 (2000); Lefranc, M.-P., Nucleic Acids Research, 29, 207-209 (2001); Lefranc, M.-P., Nucleic Acids Res., 31, 307-310 (2003); Lefranc, M.-P. et al., In Silico Biol., 5, 0006 (2004) [Epub], 5, 45-60 (2005); Lefranc, M.-P. et al., Nucleic Acids Res., 33, D593-D597 (2005) Full text; Lefranc, M.-P. et al., Nucleic Acids Research 2009 37: D1006-D1012; doi:10.1093/nar/gkn838 Full text.


IMGT founder and director: Marie-Paule Lefranc Marie-Paule.Lefranc@igh.cnrs.fr
Bioinformatics manager: Véronique Giudicelli Veronique.Giudicelli@igh.cnrs.fr
Computer manager: Patrice Duroux Patrice.Duroux@igh.cnrs.fr
Webmaster: Amélie Houles Amelie.Houles@igh.cnrs.fr
     

Citing IMGT
Warranty disclaimer and copyright notice
Privacy policy and advertisement policy

© Copyright 1995-2014 IMGT®, the international ImMunoGeneTics information system®