Protein display: Human IGH C-REGIONs

The IGHC protein display numbering is according to the IMGT unique numbering for C-DOMAIN and C-LIKE-DOMAIN.

Letters in red correspond to amino acids which are polymorphic in the other alleles.
For C-REGIONs, letters in bold correspond to additional positions in the IMGT unique numbering.
For C-REGIONs, letters between parentheses correspond to amino acids resulting from the splicing.

N (Asn, asparagine) of potential N-glycosylation sites (NXS/T, where X is different from P), (N-linked glycosylation) is shown is green (site is underlined in CHS and in pages edited before 14/10/2009).

The hinge exon(s) are shown at the end of the protein display.

_____________________________________________________________________________________________________________________________________________________________________________________________

      IGHC
      genes
_____________________________________________________________________________________________________________________________________________________________________________________________
                                 A        AB     B          BC         C      CD     D          DE           E      EF   F            FG          G             CHS
                          -------------->   ---------->             ------>       ------->              ----------->  ------->               ---------->
                          1       10   15  16  20 23      30    36 39 41 45      77     84             85  89     96 97    104    110      118  121    130       140       150
                   7654321|........|....|123|...|...... ...|.....|  |.....|1234567|......|12345677654321|..........|12|....... .....|....... ..|.........|.........|.........|
  CH1
  J00220  ,IGHA1    (A)SPTSPKVFPLSLCSTQP....DGNVVIACLVQ GFFPQ.EPLS  VTWSESGQGV....TARNFPPSQDASG.....DLYTTSSQLTLPATQC..LAGKSVTC HVKHY...TNPSQ DVTVPCP
  J00221  ,IGHA2    (A)SPTSPKVFPLSLDSTPQ....DGNVVVACLVQ GFFPQ.EPLS  VTWSESGQNV....TARNFPPSQDASG.....DLYTTSSQLTLPATQC..PDGKSVTC HVKHY...TNPSQ DVTVPCP
  K02875  ,IGHD     (A)PTKAPDVFPIISGCRHPKD..NSPVVLACLIT GYHP..TSVT  VTWYMGTQSQ....PQRTFPEIQRRD......SYYMTSSQLSTPLQQW...RQGEYKC VVQHT...ASKSK KEIFRWP
  J00222  ,IGHE     (A)STQSPSVFPLTRCCKNIPSN.ATSVTLGCLAT GYFP..EPVM  VTCDTGSLNG....TTMTLPATTLTLS.....GHYATISLLTVSGAW....AKQMFTC RVAHTPSSTDWVD NKTFS
  J00228  ,IGHG1    (A)STKGPSVFPLAPSSKSTS...GGTAALGCLVK DYFP..EPVT  VSWNSGALTS....GVHTFPAVLQSS......GLYSLSSVVTVPSSSL...GTQTYIC NVNHKP..SNTKV DKKV
  J00230  ,IGHG2    (A)STKGPSVFPLAPCSRSTS...ESTAALGCLVK DYFP..EPVT  VSWNSGALTS....GVHTFPAVLQSS......GLYSLSSVVTVPSSNF...GTQTYTC NVDHKP..SNTKV DKTV
  X03604  ,IGHG3    (A)STKGPSVFPLAPCSRSTS...GGTAALGCLVK DYFP..EPVT  VSWNSGALTS....GVHTFPAVLQSS......GLYSLSSVVTVPSSSL...GTQTYTC NVNHKP..SNTKV DKRV
  K01316  ,IGHG4    (A)STKGPSVFPLAPCSRSTS...ESTAALGCLVK DYFP..EPVT  VSWNSGALTS....GVHTFPAVLQSS......GLYSLSSVVTVPSSSL...GTKTYTC NVDHKP..SNTKV DKRV
  X06766  ,IGHGP    (A)STKGPSVFPLVPSSRSVS...EGTAALGCLVK DYFP..EPVT  VSWNSGALTR....SVHTFPAVLQSS......GLYSLSSVVTVPSSSL...GTQTYTC NVDHKP..SNTKV DKTV  
  X14940  ,IGHM     (G)SASAPTLFPLVSCENSPSD..TSSVAVGCLAQ DFLP..DSIT  LSWKYKNNSDIS..STRGFPSVLRGG.......KYAATSQVLLPSKDVMQGTDEHVVC KVQHP....NGNK EKNVPLP
  CH2
  J00220  ,IGHA1        CCHPRLSLHRPALEDLLL..GSEANLTCTLT GLRDA.SGVT  FTWTPSSGKS....AVQGPPERDLCG.......CYSVSSVLPGCAEPW..NHGKTFTC TAAYPE..SKTPL TATLSKS
  J00221  ,IGHA2        CCHPRLSLHRPALEDLLL..GSEANLTCTLT GLRDA.SGAT  FTWTPSSGKS....AVQGPPERDLCG.......CYSVSSVLPGCAQPW..NHGETFTC TAAHPE..LKTPL TANITKS
  K02878  ,IGHD  (E)CPSHTQPLGVYLLTPAVQDLWL..RDKATFTCFVV GSDL..KDAH  LTWEVAGKVPTG..GVEEGLLERHSN......GSQSQHSRLTLPRSLW..NAGTSVTC TLNHPS..LPPQR LMALREP
  J00222  ,IGHE  (V)CSRDFTPPTVKILQSSCDGGGHF.PPTIQLLCLVS GYTP..GTIN  ITWLEDGQVMD...VDLSTASTTQEG......ELASTQSELTLSQKHW..LSDRTYTC QVTYQ....GHTF EDSTKKCA
  J00228  ,IGHG1  (A)PELLGGPSVFLFPPKPKDTLMI.SRTPEVTCVVV DVSHEDPEVK  FNWYVDGVEVH...NAKTKPREEQYN......STYRVVSVLTVLHQDW..LNGKEYKC KVSNKA..LPAPI EKTISKAK
  J00230  ,IGHG2  (A)P.PVAGPSVFLFPPKPKDTLMI.SRTPEVTCVVV DVSHEDPEVQ  FNWYVDGVEVH...NAKTKPREEQFN......STFRVVSVLTVVHQDW..LNGKEYKC KVSNKG..LPAPI EKTISKTK
  X03604  ,IGHG3  (A)PELLGGPSVFLFPPKPKDTLMI.SRTPEVTCVVV DVSHEDPEVQ  FKWYVDGVEVH...NAKTKPREEQYN......STFRVVSVLTVLHQDW..LNGKEYKC KVSNKA..LPAPI EKTISKTK
  K01316  ,IGHG4  (A)PEFLGGPSVFLFPPKPKDTLMI.SRTPEVTCVVV DVSQEDPEVQ  FNWYVDGVEVH...NAKTKPREEQFN......STYRVVSVLTVLHQDW..LNGKEYKC KVSNKG..LPSSI EKTISKAK
  X06766  ,IGHGP  (T)TEPLGGPSVFLFPPKPKDTLMI.SRTPEVTCVVV DVSHEDPEVK  FNWYVDGVEVH...NAKTKPWEEQYN......STYHVVSVLTVVHQNW..LNGREYKC KVSNKG..LPAPI EKTISKTK 
  X14940  ,IGHM    (V)IAELPPKVSVFVPPRDGFFGN.PRKSKLICQAT GFSP..RQIQ  VSWLREGKQVGS..GVTTDQVQAEAKES..GPTTYKVTSTLTIKESDW..LGQSMFTC RVDHR....GLTF QQNASSMCVP
  CH3
  J00220  ,IGHA1    (G)NTFRPEVHLLPPPSEELAL..NELVTLTCLAR GFSP..KDVL  VRWLQGSQELPRE.KYLTWASRQEPSQG...TTTFAVTSILRVAAEDW..KKGDTFSC MVGHEA.LPLAFT QKTIDRLA...GKPTHVNVSVVMAEVDGTCY
  J00221  ,IGHA2    (G)NTFRPEVHLLPPPSEELAL..NELVTLTCLAR GFSP..KDVL  VRWLQGSQELPRE.KYLTWASRQEPSQG...TTTFAVTSILRVAAEDW..KKGDTFSC MVGHEA.LPLAFT QKTIDRLA...GKPTHVNVSVVMAEVDGTCY
  K02879  ,IGHD      (A)AQAPVKLSLNLLASSDPP..EAASWLLCEVS GFSP..PNIL  LMWLEDQREVNTS.GFAPARPPPQPRS.....TTFWAWSVLRVPAPPS..PQPATYTC VVSHEDSRTLLNA SRSLEVS   (Y)VTDHGPMK
  J00222  ,IGHE    (D)SNPRGVSAYLSRPSPFDLFI..RKSPTITCLVV DLAPSKGTVN  LTWSRASGKPV...NHSTRKEEKQRN......GTLTVTSTLPVGTRDW..IEGETYQC RVTHPH..LPRAL MRSTTKTS
  J00228  ,IGHG1    (G)QPREPQVYTLPPSRDELT...KNQVSLTCLVK GFYP..SDIA  VEWESNGQPEN...NYKTTPPVLDSD......GSFFLYSKLTVDKSRW..QQGNVFSC SVMHEA.LHNHYT QKSLSLSP...GK
  J00230  ,IGHG2    (G)QPREPQVYTLPPSREEMT...KNQVSLTCLVK GFYP..SDIA  VEWESNGQPEN...NYKTTPPMLDSD......GSFFLYSKLTVDKSRW..QQGNVFSC SVMHEA.LHNHYT QKSLSLSP...GK
  X03604  ,IGHG3    (G)QPREPQVYTLPPSREEMT...KNQVSLTCLVK GFYP..SDIA  VEWESSGQPEN...NYNTTPPMLDSD......GSFFLYSKLTVDKSRW..QQGNIFSC SVMHEA.LHNRFT QKSLSLSP...GK
  K01316  ,IGHG4    (G)QPREPQVYTLPPSQEEMT...KNQVSLTCLVK GFYP..SDIA  VEWESNGQPEN...NYKTTPPVLDSD......GSFFLYSRLTVDKSRW..QEGNVFSC SVMHEA.LHNHYT QKSLSLSL...GK
  X06766  ,IGHGP    (G)QPREPQVYTLPPSQK.MT...KNQVTLTCLVK GFYP..SDIT  VEWESNGQPEN...NYKTTPPMLDSN......GSFFLYSKLTVDKSRW..QQGNVFSC SVMHEG.LHNHYT QKSLSLSP...GK
  X14940  ,IGHM     (D)QDTAIRVFAIPPSFASIFL..TKSTKLTCLVT DLTTY.DSVT  ISWTRQNGEAV...KTHTNISESHPN......ATFSAVGEASICEDDW..NSGERFTC TVTHTD..LPSPL KQTISRPK
  CH4
  J00222  ,IGHE     (G)PRAAPEVYAFATPEWPGS...RDKRTLACLIQ NFMP..EDIS  VQWLHNEVQLPDA.RHSTTQPRKTKG......SGFFVFSRLEVTRAEW..EQKDEFIC RAVHEAASPSQTV QRAVSVNP...GK
  X14940  ,IGHM    (G)VALHRPDVYLLPPAREQLNL..RESATITCLVT GFSP..ADVF  VQWMQRGQPLSPE.KYVTSAPMPEPQA....PGRYFAHSILTVSEEEW..NTGETYTC VVAHEA.LPNRVT ERTVDKST...GKPTLYNVSLVMSDTAGTCY
  M
  M60193  ,IGHA1 (G)SCSVADWQMPPPYVVLDLPQETLEEETPGANLWPTTITFLTLFLLSLFYSTALTVTSVRGPSGNREGPQY
  M60194  ,IGHA2 (G)SCCVADWQMPPPYVVLDLPQETLEEETPGANLWPTTITFLTLFLLSLFYSTALTVTSVRGPSGKREGPQY
                                                     M1                        M2
  K02881  ,IGHD       (Y)LAMTPLIPQSKDENSDDYTTFDDVGSLWTTLSTFVALFILTLLYSGIVTFIK  VK (K02882)
  X63693  ,IGHE                   (E)LDVCVEEAEGEAPWTWTGLCIFAALFLLSVSYSAALTLLM  VQRFLSATRQGRPQTSLDYTNVLQPHA
  X52847  ,IGHG1               (E)LQLEESCAEAQDGELDGLWTTITIFITLFLLSVCYSATVTFFK  VKWIFSSVVDLKQTIIPDYRNMIGQGA
  AB006775,IGHG2               (E)LQLEESCAEAQDGELDGLWTTITIFITLFLLSVCYSATITFFK  VKWIFSSVVDLKQTIVPDYRNMIRQGA (AB006776)
  D78345  ,IGHG3               (E)LQLEESCAEAQDGELDGLWTTITIFITLFLLSVCYSATVTFFK  VKWIFSSVVDLKQTIIPDYRNMIGQGA
  AL928742,IGHG4*04            (E)LQLEESCAEAQDGELDGLWTTITIFITLFLLSVCYSATVTFFK  VKWIFSSVVDLKQTIVPDYRNMIRQGA
  X52849  ,IGHGP               (E)LQLEESCAEAQDGELDGLWTTITIFITLFLLSVCYSATVTFFK  VKWIFSSVVDLKQTIVPDYRNMIGQGA (X52848)
  X14940  ,IGHM                     (E)GEVSADEEGFENLWATASTFIVLFLLSLFYSTTVTLFK  VK
                              CONNECTING-REGION    | TRANSMEMBRANE-REGION      | CYTOPLASMIC-REGION
  Hinge
  J00220  ,IGHA1       (V)PSTPPTPSPSTPPTPSPS
  J00221  ,IGHA2       (V)PPPPP
  K02876  ,IGHD  [H1]  (E)SPKAQASSVPTAQPQAEGSLAKATTAPATTRNT      [H2] (G)RGGEEKKKEKEKEEQEERETKTP (K02877)
  J00228  ,IGHG1       (E)PKSCDKTHTCPPCP
  J00230  ,IGHG2          (E)RKCCVECPPCP
  X03604  ,IGHG3 [H1](E)LKTPLGDTTHTCPRCP  [H2] (E)PKSCDTPPPCPRCP  [H3] (E)PKSCDTPPPCPRCP  [H4] (E)PKSCDTPPPCPRCP
  K01316  ,IGHG4          (E)SKYGPPCPSCP
  X06766  ,IGHGP          (E)PKTPCCDTTHTCPPCA


Created: 23/03/2001
Last updated: Friday, 27-May-2016 21:03:30 CEST
Authors: Christèle Martinez-Jean and Nathalie Bosc

Software material and data coming from IMGT server may be used for academic research only, provided that it is referred to IMGT®, and cited as "IMGT®, the international ImMunoGeneTics information system® http://www.imgt.org (founder and director: Marie-Paule Lefranc, Montpellier, France)." References to cite: Lefranc, M.-P. et al., Nucleic Acids Res., 27:209-212 (1999); doi: 10.1093/nar/27.1.209 Full text Cover; Ruiz, M. et al., Nucleic Acids Res., 28:219-221 (2000); doi: 10.1093/nar/28.1.219 Full text; Lefranc, M.-P., Nucleic Acids Res., 29:207-209 (2001); doi: 10.1093/nar/29.1.207 Full text; Lefranc, M.-P., Nucleic Acids Res., 31:307-310 (2003); doi: 10.1093/nar/gkg085 Full text; Lefranc, M.-P. et al., In Silico Biol., 5, 0006 (2004) [Epub], 5:45-60 (2005); Lefranc, M.-P. et al., Nucleic Acids Res., 33:D593-597 (2005); doi: 10.1093/nar/gki065 Full text; Lefranc, M.-P. et al., Nucleic Acids Res., 37:D1006-1012 (2009); doi: 10.1093/nar/gkn838 Full text; Lefranc, M.-P. et al., Nucleic Acids Res., 43:D413-422 (2015); doi: 10.1093/nar/gku1056 Full text.
For any other use please contact Marie-Paule Lefranc Marie-Paule.Lefranc@igh.cnrs.fr.

CNRS Université de Montpellier European Commission
IMGT® Founder and Executive Director Emeritus:
Marie-Paule Lefranc Marie-Paule.Lefranc@igh.cnrs.fr
IMGT® Director:
Sofia Kossida Sofia.Kossida@igh.cnrs.fr
Bioinformatics manager:
Véronique Giudicelli Veronique.Giudicelli@igh.cnrs.fr
Computer manager:
Patrice Duroux Patrice.Duroux@igh.cnrs.fr
Webmaster:
Amélie Houles

Citing IMGT | Warranty disclaimer and copyright notice | Privacy policy and advertisement policy

© Copyright 1995-2017 IMGT®, the international ImMunoGeneTics information system®