Only the *01 allele of each functional, ORF and in-frame pseudogene V-REGION is shown.
Letters in red correspond to amino acids which are polymorphic in the other alleles.
For C-REGIONs, letters in bold correspond to additional positions in the IMGT unique numbering.
For C-REGIONs, letters between parentheses correspond to amino acids resulting from the splicing.
___________________________________________________________________________________________________________________________________________________ IGHV FR1-IMGT CDR1-IMGT FR2-IMGT CDR2-IMGT FR3-IMGT CDR3-IMGT gene (1-26) (27-38) (39-55) (56-65) (66-104) (105-115) __________________________ __________________________ ____________ _________________ __________ _______________________________________ ___________ 1 10 20 30 40 50 60 70 80 90 100 110 .........|.........|...... ...|........ .|.........|..... ....|..... ....|.........|.........|.........|.... .....|..... #c M26182 ,IGHV1S1 (S)QTLTESEP.AVKKPGESHKLTCTAS GFTFSNYW.... MGWIRQAPGKGLEWLAT LKYNSAEE.. YYSQSVK.GRFTISRDNSKNQLYLQMNSLRAEDTAVYYC AR......... #c M26579 ,IGHV2S1 (C)VELTQPGS.MAVKPGESLTISCKVS GYSLTDSTYC.. TNWIRQPVGKALEWIGR ICGSGNT... YYKDSLK.NKFTISRDTSSSTVKLQGRSLQTEDTAVYYC AR.........
The proteolytic cleavage site between the leader peptide and the V-REGION is putative and the assignment of amino acid 1 to one or the other region is uncertain.
IMGT note:
Probable CDR3-IMGT lenght but needs to be confirmed with germline sequences.
Created: 08/09/1999
Author: Sylvaine Artero
Contact: Marie-Paule Lefranc
Software material and data coming from IMGT server may be used for academic research only, provided that it is referred to IMGT®, and cited as "IMGT®, the international ImMunoGeneTics information system® http://www.imgt.org (founder and director: Marie-Paule Lefranc, Montpellier, France)." References to cite: Lefranc, M.-P. et al., Nucleic Acids Research, 27, 209-212 (1999) Cover of NAR; Ruiz, M. et al., Nucleic Acids Research, 28, 219-221 (2000); Lefranc, M.-P., Nucleic Acids Research, 29, 207-209 (2001); Lefranc, M.-P., Nucleic Acids Res., 31, 307-310 (2003); Lefranc, M.-P. et al., In Silico Biol., 5, 0006 (2004) [Epub], 5, 45-60 (2005); Lefranc, M.-P. et al., Nucleic Acids Res., 33, D593-D597 (2005) Full text; Lefranc, M.-P. et al., Nucleic Acids Research 2009 37: D1006-D1012; doi:10.1093/nar/gkn838 Full text.
|
IMGT founder and director: Marie-Paule Lefranc
Marie-Paule.Lefranc@igh.cnrs.fr
Bioinformatics manager: Véronique Giudicelli Veronique.Giudicelli@igh.cnrs.fr Computer manager: Patrice Duroux Patrice.Duroux@igh.cnrs.fr Webmaster: Chantal Ginestoux Chantal.Ginestoux@igh.cnrs.fr |
|
|
|
|
Citing IMGT © Copyright 1995-2012 IMGT®, the international ImMunoGeneTics information system® |
|||