Protein display: South American short-tailed grey opossum (Monodelphis domestica) IGH C-REGIONs

The IGHC protein display numbering is according to the IMGT unique numbering for C-DOMAIN and C-LIKE-DOMAIN.

Letters in red correspond to amino acids which are polymorphic in the other alleles.
For C-REGIONs, letters in bold correspond to additional positions in the IMGT unique numbering.
For C-REGIONs, letters between parentheses correspond to amino acids resulting from the splicing.

N (Asn, asparagine) of potential N-glycosylation sites (NXS/T, where X is different from P), (N-linked glycosylation) is shown is green (site is underlined in CHS and in pages edited before 14/10/2009).

The hinge exon(s) are shown at the end of the protein display.

_____________________________________________________________________________________________________________________________________________________________________________________________

      IGHC
      genes
_____________________________________________________________________________________________________________________________________________________________________________________________
                                     A        AB     B          BC         C      CD     D          DE           E      EF   F            FG          G             CHS
                              -------------->   ---------->             ------>       ------->              ----------->  ------->               ---------->
                              1       10   15  16  20 23      30    36 39 41 45      77     84             85  89     96 97    104    110      118  121    130       140       150
                       7654321|........|....|123|...|...... ...|.....|  |.....|1234567|......|12345677654321|..........|12|....... .....|....... ..|.........|.........|.........|
  CH1
  AF012110,IGHA c       (V)PKTSPTVFPMSLCDSRT....GDSVALGCLAQ GFFP..EPVT  LSWNYNGSEG....TVRSYPAMLSGN.......TYLQTSVLDLPANQC....PEAYKC GAKHY....DTSV DANVPCPV
  AF035194,IGHE c       (E)PLTAPSVFPLMSCCDSNS...GGKAFLGCLAT GYFP..ESVT  INWNSEVLDE....IITNFPATYDPTS.....GRYTTTSQLTVSDL.....SDQEFTC SVDHLP..TSTKI KKTLSL
  AF035195,IGHG c       (A)RPTAPSVFPLVSSCGQET...QAQMALGCLVT SYFP..EPVT  VTWNSGTTTS....GIQTYPSVLQPS......GLYTLTSQLTIPADSW...SSQSYTC NVAHPA..TSTKI DKKI
  AF012109,IGHM c       (A)LPSAPNLFSLSPCLNSGVE..DAPVAVGCLAK DFLP..DSIN  FSWTYQNQSAVSHTDLKIFPSQMSGP.......TYTATSQVILPALDV..LQDSYLVC KASHL....NSNK QVQVSLP
  CH2
  AF012110,IGHA c            SGVHVSLSGPSLESLLL..GIGANLTCTLS GIKNS.NGAT  FTWVHDTAQASTLRPIQGAPEQDSNG.......KYRVSSVLEICTEEW..LRGDTFSC TVSHS...EIETT TKTIYKPK
  AF035194,IGHE c  (P)ECGPVTIIPPTVKLFHSSCDPRGDA.HSTIQLLCLVS GFSP..AKVH  VTWLVDGQEAEN..LFPYTTRPKREGG.....QTFSLQSEVNITQGQW..MSSNTYTC HVKHN....GSIF EDSAQKCS
  AF035195,IGHG c       (V)DAGGPSVFVFPPNPQDVLKL.SRSPKVTCMVV DVSDA.SGVQ  ITWFKGEEEV....SSPKLTQKKLNN......GTFQVVSNLPVVHQEW..LKGTSYTC KVNTSE..LPVVE RKTISHTK
  AF012109,IGHM c      (D)TTSSSPNVTVYIPPRDAFSNSGLRKSKLICQVT DFRP..REIK  LTWLREGRPVSS..GFSTGQVLPDGS......GTYFLQSSLTINESDW..LSQSTFTC RVDHL....NAQF QKNVSSSCAI
  CH3
  AF012110,IGHA c       (V)PQIPPQIYLLAPSADEQAL..NEMVSITCLVR GFSP..EDVF  IRWLKGSEELPKK.DYITSNPYPEPKS....TSTYMVSSILQVQSTDW..KNENKYSC VVGHEA.LPLNFT QQTIDRLC...GKPTNVNVSVIMSDIYGTCY
  AF035194,IGHE c      (D)TDPRGISAYILPPTPQDLFV..KKVPTIGCLIV DLASA.ENVK  VTWSRESGGPV...NPSSLVVKEQYN......GTFTVTSHLPVNTDDW..IEGDTYTC RLESPD..MPVPL IRTISKAP
  AF035195,IGHG c       (G)ERKKPDIYVFGPHPDELKQ..KDDVSITCLVT NFFP..EDVV  IEWQKNNNPESED.KYYTTPTTREKS.......TYFFYSKLIVKKRDW..DNQNSYTC VVLHEA.FPNQIS QRTISASP...GK
  AF012109,IGHM c       (S)TDSPIEAFAIPPSFASIFV..TKSAKLTCVVT NLPTY.DSLS  ISWTRKDGQLL...KTKVKVFSSHPN......GTFTAEGEATVCAEEW..NSGEAFKC IVTHSD..HPVPL KKEIFKPQ
  CH4
  AF035194,IGHE c       (G)KRLAPEVYMLPPSPEET....GTTRTVTCLIR GFYP..SEIS  VQWLFNNEEDHTG.HHTTTRPQKDHGT....DPSFFLYSRMLVNKSIW..EKGNLVTC RVVHEALPGSRTL EKSLHYSA...GN
  AF012109,IGHM c      (E)VDLHAPSVYLLHPNPEELSL..RESVTVTCMMK DFSP..PDVF  VQWMHKGQPIPSE.KYVTSSPHQDPQK....GGRYFSYSILTVSEAQW..NSGDPFTC VVAHEA.LPLSST ERTVDKST...GKPTLVNVSLVLADTTNTCY
  Hinge
  AF012110,IGHA c        (V)PPRPCDCP
  AF035195,IGHG c        (E)ATTTTCPCCKCNT
c: cDNA sequence


Created: 01/07/2002
Last updated: Friday, 27-May-2016 21:03:31 CEST
Author: Christèle Martinez-Jean

Software material and data coming from IMGT server may be used for academic research only, provided that it is referred to IMGT®, and cited as "IMGT®, the international ImMunoGeneTics information system® http://www.imgt.org (founder and director: Marie-Paule Lefranc, Montpellier, France)." References to cite: Lefranc, M.-P. et al., Nucleic Acids Res., 27:209-212 (1999); doi: 10.1093/nar/27.1.209 Full text Cover; Ruiz, M. et al., Nucleic Acids Res., 28:219-221 (2000); doi: 10.1093/nar/28.1.219 Full text; Lefranc, M.-P., Nucleic Acids Res., 29:207-209 (2001); doi: 10.1093/nar/29.1.207 Full text; Lefranc, M.-P., Nucleic Acids Res., 31:307-310 (2003); doi: 10.1093/nar/gkg085 Full text; Lefranc, M.-P. et al., In Silico Biol., 5, 0006 (2004) [Epub], 5:45-60 (2005); Lefranc, M.-P. et al., Nucleic Acids Res., 33:D593-597 (2005); doi: 10.1093/nar/gki065 Full text; Lefranc, M.-P. et al., Nucleic Acids Res., 37:D1006-1012 (2009); doi: 10.1093/nar/gkn838 Full text; Lefranc, M.-P. et al., Nucleic Acids Res., 43:D413-422 (2015); doi: 10.1093/nar/gku1056 Full text.
For any other use please contact Marie-Paule Lefranc Marie-Paule.Lefranc@igh.cnrs.fr.

CNRS Université de Montpellier European Commission
IMGT® Founder and Executive Director Emeritus:
Marie-Paule Lefranc Marie-Paule.Lefranc@igh.cnrs.fr
IMGT® Director:
Sofia Kossida Sofia.Kossida@igh.cnrs.fr
Bioinformatics manager:
Véronique Giudicelli Veronique.Giudicelli@igh.cnrs.fr
Computer manager:
Patrice Duroux Patrice.Duroux@igh.cnrs.fr
Webmaster:
Amélie Houles

Citing IMGT | Warranty disclaimer and copyright notice | Privacy policy and advertisement policy

© Copyright 1995-2017 IMGT®, the international ImMunoGeneTics information system®