Protein display: Bornean orangutan (Pongo pygmaeus) IGH C-REGIONs

The IGHC protein display numbering is according to the IMGT unique numbering for C-DOMAIN and C-LIKE-DOMAIN.

Letters in red correspond to amino acids which are polymorphic in the other alleles.
For C-REGIONs, letters in bold correspond to additional positions in the IMGT unique numbering.
For C-REGIONs, letters between parentheses correspond to amino acids resulting from the splicing.

N (Asn, asparagine) of potential N-glycosylation sites (NXS/T, where X is different from P), (N-linked glycosylation) is shown is green (site is underlined in CHS and in pages edited before 14/10/2009).

The hinge exon(s) are shown at the end of the protein display.

_____________________________________________________________________________________________________________________________________________________________________________________________

      IGHC
      genes
_____________________________________________________________________________________________________________________________________________________________________________________________
                                    A        AB     B          BC         C      CD     D          DE           E      EF   F            FG          G             CHS
                             -------------->   ---------->             ------>       ------->              ----------->  ------->               ---------->
                             1       10   15  16  20 23      30    36 39 41 45      77     84             85  89     96 97    104    110      118  121    130       140       150
                      7654321|........|....|123|...|...... ...|.....|  |.....|1234567|......|12345677654321|..........|12|....... .....|....... ..|.........|.........|.........|
  CH1                          
  X53704  ,IGHA        (A)SPTSPKVFPLNFCSIQP....DGNVVVACLVQ GFFPQ.EPLS  VTWSESGQGV....TARNFPPSQDPTG.....GLYTTSSQLTLPATQC..QDGKSVTC HVKHY...TNPSQ DVTVPCR
  M15399  ,IGHE        (A)STQSPSIFPLTHCCKNIPSN.ATSVTLGCLVT GYFP..EPVM  VTWDASSLHG....TTMTLPATTLTPS.....GHYATISLLTVSGAW....AKQMFTC RVAHTPSSADWVY NKTFG
  AF300428,IGHG1                                                                           AVLQSS......GLYSLSSVVTVPSSSL...GTQTYIC NVDHKP..SNTKV DKKV
  AF300426,IGHG2                                                                           AVLQSS......GLYSLSSVVTVPSSSL...GSQTYTC NVDHKP..SNTKV DKKV
  AF300452,IGHG3                                                                           AVLQSS......GLYSLSSVVTVPSSSL...GTQTYTC NVDHKP..SNTKV DKRV
  CH2 
  X53704  ,IGHA (1)        CGQPQLSLHRPALEDLLL..GSEANLTCTLT GLTNA.SGAT  FTWTPSSGKN....AVQRPPERDLCG.......CYSVSSVLPGCADPW..NHGQTFTC TAEHPE..LKTQL TATLSKS
  M15399  ,IGHE     (V)CSRDFTPPTVKILQSSCDGGGHF.PLTIQLLCLVS GYTP..GTIN  ITWLEDGQVMD...VDLSTASATQEG......ELASTQSELTLSQKRW..LSDRTYTC QVTYQ....GDTF EDSTKKCA
  AF300428,IGHG1     (A)PELLGGPSVFLFPPKPKDTLMI.SRTPEVTC
  AF300426,IGHG2     (G)LTPPEGPSVFLFPPKPKDTLMI.SRTPEVTC
  AF300452,IGHG3     (E)PELLGGPSVFLFPPKPKDTLMI.SGTPEVTC
  CH3
  X53704  ,IGHA        (G)NTFRPEVHLLPPPSEELAL..NELVTLTCLAR GFSP..KDVL  VRWLQGSQELPRE.KYLTWASRQEPSQG...TTTYAVTSILRVAAEDW..KKGDTFSC MVGHEA.LPLAFT QKTIDRLA...GKPTHVNVSVVMAEVDGTCY
  M15399  ,IGHE       (D)SNPRGLSAYLSRPSPFDLFI..RKSPTPTCLVV DLAPSKGTVN  LTWSRASGKPV...NHSTGKQEKQRN......GTLTVTSTLPVGTRDW..IEGETYQC RVTHPH..LPRAL VRSTTKTS   
  CH4
  M15399  ,IGHE        (G)PRAAPEVYAFATPEGPGS...RDKRTLACLIQ NFMP..EDIS  VQWLHNEVQLPDA.RHSTTQPHKTKG......SSFFVFSRLEVTRAEW..EQKDEFIC RAVHEAASPSQTV QRTVSVNP...GK
  Hinge 
  X53704  ,IGHA	            (V)PRPTPTPSTPPCPPPS
  AF300428,IGHG1       	    (E)PKSCDTPRPCPPCP
  AF300426,IGHG2            (E)LIIPCCDTPRLCPPCP
  AF300452,IGHG3       [H1] (E)LKTPHDDTTHPCTPCP   [H2] (E)PKSCDTPPPCPRCPRCP   [H3] (E)PKSCDTPPTCPRCP

IMGT note:
(1) In the IGHA gene, the hinge (H) and CH2 are joined in a single exon.


Created: 12/11/2002
Author: Nathalie Bosc

Software material and data coming from IMGT server may be used for academic research only, provided that it is referred to IMGT®, and cited as "IMGT®, the international ImMunoGeneTics information system® http://www.imgt.org (founder and director: Marie-Paule Lefranc, Montpellier, France)." References to cite: Lefranc, M.-P. et al., Nucleic Acids Res., 27:209-212 (1999); doi: 10.1093/nar/27.1.209 Full text Cover; Ruiz, M. et al., Nucleic Acids Res., 28:219-221 (2000); doi: 10.1093/nar/28.1.219 Full text; Lefranc, M.-P., Nucleic Acids Res., 29:207-209 (2001); doi: 10.1093/nar/29.1.207 Full text; Lefranc, M.-P., Nucleic Acids Res., 31:307-310 (2003); doi: 10.1093/nar/gkg085 Full text; Lefranc, M.-P. et al., In Silico Biol., 5, 0006 (2004) [Epub], 5:45-60 (2005); Lefranc, M.-P. et al., Nucleic Acids Res., 33:D593-597 (2005); doi: 10.1093/nar/gki065 Full text; Lefranc, M.-P. et al., Nucleic Acids Res., 37:D1006-1012 (2009); doi: 10.1093/nar/gkn838 Full text; Lefranc, M.-P. et al., Nucleic Acids Res., 43:D413-422 (2015); doi: 10.1093/nar/gku1056 Full text.
For any other use please contact Marie-Paule Lefranc Marie-Paule.Lefranc@igh.cnrs.fr.

CNRS Université de Montpellier European Commission
IMGT® Founder and Executive Director Emeritus:
Marie-Paule Lefranc Marie-Paule.Lefranc@igh.cnrs.fr
IMGT® Director:
Sofia Kossida Sofia.Kossida@igh.cnrs.fr
Bioinformatics manager:
Véronique Giudicelli Veronique.Giudicelli@igh.cnrs.fr
Computer manager:
Patrice Duroux Patrice.Duroux@igh.cnrs.fr
Webmaster:
Amélie Houles

Citing IMGT | Warranty disclaimer and copyright notice | Privacy policy and advertisement policy

© Copyright 1995-2017 IMGT®, the international ImMunoGeneTics information system®