IMGT Web resources: IMGT repertoire Protein display: Pig (Sus scrofa) IGH C-REGIONs

The IGHC protein display numbering is according to the IMGT unique numbering for C-DOMAIN and C-LIKE-DOMAIN.

Letters in red correspond to amino acids which are polymorphic in the other alleles.
For C-REGIONs, letters in bold correspond to additional positions in the IMGT unique numbering.
For C-REGIONs, letters between parentheses correspond to amino acids resulting from the splicing.

N (Asn, asparagine) of potential N-glycosylation sites (NXS/T, where X is different from P), (N-linked glycosylation) is shown is green (site is underlined in CHS and in pages edited before 14/10/2009).

The hinge exon(s) are shown at the end of the protein display.

_____________________________________________________________________________________________________________________________________________________________________________________________

      IGHC
      genes
_____________________________________________________________________________________________________________________________________________________________________________________________
                                    A        AB     B          BC         C      CD     D          DE           E      EF   F            FG          G             CHS
                             -------------->   ---------->             ------>       ------->              ----------->  ------->               ---------->
                             1       10   15  16  20 23      30    36 39 41 45      77     84             85  89     96 97    104    110      118  121    130       140       150
                      7654321|........|....|123|...|...... ...|.....|  |.....|1234567|......|12345677654321|..........|12|....... .....|....... ..|.........|.........|.........|
  CH1
  AB699687  ,IGHA      (V)SETSPKIFPLTLGSSEP....AGYVVIACLVR DFFPS.EPLT  VTWSPSREGV....IVRNFPPAQAGG.......LYTMSSQLTLPVEQC..PADQILKC QVQHL...SKSSQ SVNVPCK
  AB699686  ,IGHD      (E)RQSAPSLFPLVSCVSPPSD..ESLVALGCLAR DFLP..SSVT  FSWNYKNSSKVSSQNIQDFPSVLRGG.......KYLASSRVLLPSVSIPQDPEAFLVC EVQHP....SGTK SVSISGP
  AB699687  ,IGHE      (A)SIQGPLVYPLTSCCKTG....ATSKTLGCLVR GYFP..EPVT  VTWDTGSLNS....STLTFPAVQDSSS.....SLYTVTSQVTILGEW....TNQKLTC SVAHA....ANTT IRTIT
  AB699686  ,IGHG1     (A)PKTAPSVYPLAPCGRDTS...GPNVALGCLAS SYFP..EPVT  MTWNSGALTS....GVHTFPSVLQPS......GLYSLSSMVTVPASSL...SSKSYTC NVNHPA..TTTKV DKRV
  U03779    ,IGHG2  c  (A)PKTAPSVYPLAPCSRDTS...GPNVALGCLAS SYFP..EPVT  VTWNSGALSS....GVHTFPSVLQPS......GLYSLSSMVTVPASSL...SSKSYTC NVNHPA..TTTKV DKRV
  AB699686  ,IGHG3     (A)YNTAPSVYPLAPCGRDVS...DHNVALGCLVS SYFP..EPVT  VTWNSGALSR....VVHTFPSVLQPS......GLYSLSSMVIVAASSL...STLSYTC NVYHPA..TNTKV DKRV
  EU372654  ,IGHG4     (A)PKTAPSVYPLAPCGRDVS...GPNVALGCLAS SYFP..EPVT  VTWNSGALTS....GVHTFPSVLQPS......GLYSLSSMVTVPASSL...SSKSYTC NVNHPA..TTTKV DKRV
  AB699686  ,IGHG5-1   (A)PKTAPSVYPLAPCGRDVS...DHNVALGCLAS SYFP..EPVT  VTWNWGAQTS....GVHTFPSVLQPS......GLYSLSSTVTVPAHSL...SSKCFTC NVNHPA..TTTKV DLCV
  AB699686  ,IGHG5-2   (A)PKTAPSVYPLAPCSRDTS...GPNVALGCLVS SYFP..ELVT  VTWNSGALTS....GVHTFPSVLQPS......GLYSLSSMVTVPAHSL...SSKRYTC NVNHPA..TKTKV DLCV
  AB699687  ,IGHG6-1   (A)PKTAPSVYPLAPCGRDTS...GPNVALGCLAS SYFP..EPVT  VTWNSGALTS....GVHTFPSVLQPS......GLYSLSSMVTVPASSL...SSKSYTC NVNHPA..TTTKV DKRV
  AB699687  ,IGHG6-2   (A)PKTAPSVYPLAPCGRDTS...GPNVALGCLAS SYFP..EPVT  VTWNSGALTS....GVHTFPSVLQPS......GLYSLSSMVTVPARSS...SRKCFTC NVNHPA..TTTKV DLCV
  AB699686  ,IGHM      (E)SQSAPNLFPLVSCVSPPSD..ESLVALGCLAR DFLP..SSVT  FSWNYKNSSKVSSQNIQDFPSVLRGG.......KYLASSRVLLPSVSIPQDPEAFLVC EVQHP....SGTK SVSISGP

  
  CH2
  AB699687  ,IGHA          CCKPSLSLQPPALADLLL..GSNASLTCTLS GLKKS.EGVS  FTWQPSGGKD....AVQASPTRDSCG.......CYSVSSILPGCADPW..NKGETFSC TAAHSE..LKSAL TATITKPK
  AB699686  ,IGHD   (A)CQNHTRPPSVYLLLPPLQGLWL..RAEATFTCLAV GQDL..QEAR  LSWAVAEEPQGG..RMEEGPTEHTNG.......SWSLSSRLALPRSSW..AAGAPVTC RLSGP....GLRS LVTAEARREH
  AB699687  ,IGHE   (G)CTKNFTDPSLRFFYSSCDPHGDA.QATIHLRCYIS GYTP..GKMK  VTWLVDGQEDRN..LFSYTAPDQLEG......KLASTYSEVNITQGQW..ASQITYTC QVSYY....GFIY EKHALRCT
  AB699686  ,IGHG1    (G)CEVAGPSVFIFPPKPKDTLMI.SQTPEVTCVVV DVSKEHAEVQ  FSWYVDGVEVH...TAETRPKEEQFN......STYRVVSVLPIQHQDW..LKGKEFKC KVNNVD..LPAPI TRTISKAI
  U03779    ,IGHG2 c (A)ACESPGPSVFIFPPKPKDTLMI.SRTPQVTCVVV DVSQENPEVQ  FSWYVDGVEVH...TAQTRPKEEQFN......STYRVVSVLPIQHQDW..LNGKEFKC KVNNKD..LPAPI TRIISKAK
  AB699686  ,IGHG3   (A)AEVLGAPSVFLFPPKPKDILMI.SRTPKVTCVVV DVSQEEAEVQ  FSWYVDGVQLY...TAQTRPMEEQFN......STYRVVSVLPIQHQDW..LKGKEFKC KVNNKD..LLSPI TRTISKAT
  EU372654  ,IGHG4    (A)CEGPGPSAFIFPPKPKDTLMI.SRTPKVTCVVV DVSQENPEVQ  FSWYVDGVEVH...TAQTRPKEEQFN......STYRVVSVLLIQHQDW..LNGKEFKC KVNNKD..LPAPI TRIISKAK
  AB699686  ,IGHG5-1     (V)AGPSVFIFPPKPKDILMI.SRTPEVTCVVV DVSKEHAEVQ  FSWYVDGEEVH...TAETRPKEEQFN......STYRVVSVLPIQHEDW..LKGKEFEC KVNNED..LPGPI TRIISKAK
  AB699686  ,IGHG5-2  (G)CEVAGPSVFIFPPKPKDILMI.SRTPEVTCVVV DVSKEHAEVQ  FSWYVDGVEVH...TAETRPKEEQFN......STYRVVSVLPIQHEDW..LKGKEFEC KVNNED..LPGPI TRIISKAK
  AB699687  ,IGHG6-1  (A)CEGPGPSAFIFPPKPKDTLMI.SRTPKVTCVVV DVSQENPEVQ  FSWYVDGVEVH...TAQTRPKEEQFN......STYRVVSVLPIQHQDW..LNGKEFKC KVNNKD..LPAPI TRIISKAK
  AB699687  ,IGHG6-2  (A)CEGPGPSAFIFPPKPKDTLMI.SRTPQVTCVVV DVSQENPEVQ  FSWYVDGVEVH...TAQTRPKEAQFN......STYRVVSVLPIQHEDW..LKGKEFEC KVNNKD..LPAPI TRIISKAK
  AB699686  ,IGHM     (V)VEEQPPVLNIFVPTRESFSSTPQRTSKLICQAS DFSP..KQIS  MAWFRDGKRVVS..GVSTGPVETLQSS....PVTYRLHSMLTVTESEW..LSQSVFTC QVEHK....GLNY EKNASSLCTS
 
  CH3
  AB699687  ,IGHA      (V)NTFRPQVHLLPPPSEELAL..NELVTLTCLVR GFSP..KDVL  VRWLQGGQELPRD.KYLVWESLPEPGQA...IPTYAVTSVLRVDAEDW..KQGDTFSC MVGHEA.LPLAFT QKTIDRLA...GKPTHVNVSVVMAEAEGICY
  AB699686  ,IGHD    (A)ALAPSNLAVRVLTAPGPLAFT..KAASWLLCEVS SFSP..LDIL  LTWLEGQQEVDPS.WFATARPAAQPGN.....PTFRTWSVLRVPASPG..HQDATYTC VVGHEA..SRTLL NASWRLDT  (G)PLLIQQRLGAEWKASKRAPASPEA
  AB699687  ,IGHE    (A)ESEPRGVSAYLSPPTPLDLYV..HKSPKLTCLVV DLASS.ENVN  LLWSRENKGGVILPPPGPPVIKPQFN......GTFSATSTLPVNVSDW..IEGETYYC NVTHPD..LPKPI LRSISKGP
  AB699686  ,IGHG1  (2)(G)QSREPQVYTLPPPAEELS...RSKVTVTCLVI GFYP..PDIH  VEWKSNGQPEPEG.NYRTTPPQQDVD......GTFFLYSKLAVDKARW..DHGETFEC AVMHEA.LHNHYT QKSISKTQ...GK
  U03779   ,IGHG2 c (2)(G)QTREPQVYTLPPHAEELS...RSKVSITCLVI GFYP..PDID  VEWQRNGQPEPEG.NYRTTPPQQDVD......GTYFLYSKFSVDKASW..QGGGIFQC AVMHEA.LHNHYT QKSISKTP...GK
  AB699686  ,IGHG3  (2)(G)PSRVPQVYTLPPAWEELS...KSKVSITCLVT GFYP..PDID  VEWQSNGQQEPEG.NYRTTPPQQDVD......GTYFLYSKLAVDKVRW..QRGDLFQC AVMHEA.LHNHYT QKSVSQTP...GK
  EU372654  ,IGHG4  (2)(G)QTREPQVYTLPPPTEELS...RSKVTLTCLVT GFYP..PDID  VEWQRNGQPEPEG.NYRTTPPQQDVD......GTYFLYSKLAVDKASW..QRGDTFQC AVMHEA.LHNHYT 
  AB699686  ,IGHG5-1(2)(G)VVRSPEVYTLPPPAEELS...KSIVTLTCLVK SFFP..PFIH  VEWKINGKPEPEN.AYRTTPPQEDED......GTYFLYSKFSVEKFRW...HSGGIHC AVMHEA.LHNHYT EKSVSQTP...GK
  AB699686  ,IGHG5-2(2)(G)VVRSPEVYTLPPPAEELS...KSKVTLTCLVK SFFP..PFIH  VGWKINGQLEPEG.NYHTTPPQEDED......GTYFLYSKLAVDKARL...QSGGIHC AVMHEA.LHNHYT EKSVSLTP...GK
  AB699687  ,IGHG6-1(2)(G)QTREPQVYTLPPPTEELS...RSKLSVTCLIT GFYP..PDID  VEWQRNGQPEPEG.NYRTTPPQQDVD......GTYFLYSKLAVDKASW..QRGDPFQC AVMHEA.LHNHYT QKSIFKTP...GN
  AB699687  ,IGHG6-2(2)(G)PSREPQVYTLSPSAEELS...RSKVSITCLVT GFYP..PDID  VEWKSNGQPEPEG.NYRTTPPQQDVD......GTYFLYSKLAVDKASW..QRGDPFQC AVMHEA.LHNHYT QKSVSKTQ...GK
  AB699686  ,IGHM      (N)PNSPITVFAIAPSFAGIFL..TKSAKLSCLVT GLVTR.ESLN  ISWTRQDGEVL...KTSIVFSEIYAN......GTFGARGEASVCVEDW..ESGDRFTC TVTHTD..LPSPL KQSVSKPR
  CH4
  AB699687  ,IGHE      (G)KRVTPEVYVLWSPDELK....KGRLTLTCLIQ NFFP..ADIS  VLWLRNDAPVQAD.RHSTTRPHKASDS....LPSFFVYSRLVVSQSDW...EQNKFAC EVIHEALPGSRTL QKEVSKNP...GK
  AB699686  ,IGHM     (G)IARHMPSVYVLPPAPEELSL..QEWASVTCLVK GFSP..ADVF  VQWLQKGEPVSAD.KYVTSAPVPEPEPK..APASYFVQSVLTVSAKDW..SDGETYTC VVGHEA.LPHTVT ERTVDKST...GKPTLYNVSLVLSDTASTCY
  M
  AB699687  ,IGHA (G)PLCLTGHRDPFPWLVLDLLREGPEEETPEASLWPTTVTLLTLFLLSLFYSTALTVTSIRGPADSREGPQY
                                           M1                                  M2
  AB699686  ,IGHD       (G)LATLTPGSQDEGSDDYVDLEDAGRLWLTFTVLFLVTLLYSGFVTFLK     VK 
  AB699687  ,IGHE             (E)LALEDLCAEEAESQELEAMWTGLLVFTTLFLLSVSYGAAITLCK  VKWVLAAILQEQPPASHDYTNVQEPAA
  AB699686  ,IGHG1             (E)LLLEESCADAQDGELDGLWTTISIFITLFLLSVCYSATVTLFK  VKWIFSSVVELKRTIVPDYRNMIGQGA
  AB699686  ,IGHG3             (E)LLLEESCADAQDGELDGLWTTISIFITLFLLSVCYSATVTLFK  VKWIFSPVVELKRTIVPDYRNMIGQGA
  AB699686  ,IGHG5-1           (E)LLLEESCADAQDGELDGLWTTISIFITLFLLSVCYSATVTLFK  VKWIFSSVVELKRTIVPDYRNMIGQGA
  AB699686  ,IGHG5-2           (E)LLLEESCADAQDGELDGLWTTISIFITLFLLSVCYSATVTLFK  VKWIFSSVVELKRTIVPDYRNMIGQEA
  AB699687  ,IGHG6-1           (E)LLLEESCADAQDGELDGLWTTISIFITLFLLSVCYSATVTLFK  VKWIFSSVVELKRTIVPDYRNMIGQGA
  AB699687  ,IGHG6-2           (E)LLLEESCADAQDGELDGLWTTISIFITLFLLSVCYSATVTLFK  VKWIFSSVVELKRTIVPDYRNMIGQGA
  AB699686  ,IGHM                   (E)GEVSAEEEGFENLNTMASTFIVLFLLSLFYSTTVTLFK  VK
                             CONNECTING-REGION    | TRANSMEMBRANE-REGION       | CYTOPLASMIC-REGION

 Hinge
  AB699687  ,IGHA        (V)LPSDPCPQ
  AB699686  ,IGHD    [H1](A)SRQLPAPAGTPGPTLSTVSTKALTTPRIP  [H2] (V)RSTVRGQPGAQTQEPPEGPRG  
  AB699686  ,IGHG1       (G)TKTKPPCPICP
  U03779    ,IGHG2       (G)TKTKPPCPICP
  AB699686  ,IGHG3       (D)IEPPTPICPEICSCP
  EU372654  ,IGHG4       (G)TKTKPPCPICP
  AB699686  ,IGHG5-1     (G)KKTKPRCPICP
  AB699686  ,IGHG5-2     (G)RPCPICP
  AB699687  ,IGHG6-1     (G)RPCPICP
  AB699687  ,IGHG6-2     (G)RPCPICP
 
c: cDNA sequence


IMGT notes:
(2) The CD strand is 6 amino acid long (45.1 to 45.6) as in the other artiodactyls (Bovidae and Camelidae).


Created: 01/07/2002
Last updated: Friday, 27-May-2016 21:03:31 CEST
Author: Saida Saljoqi, Christèle Martinez-Jean

Software material and data coming from IMGT server may be used for academic research only, provided that it is referred to IMGT®, and cited as "IMGT®, the international ImMunoGeneTics information system® http://www.imgt.org (founder and director: Marie-Paule Lefranc, Montpellier, France)." References to cite: Lefranc, M.-P. et al., Nucleic Acids Res., 27:209-212 (1999); doi: 10.1093/nar/27.1.209 Full text Cover; Ruiz, M. et al., Nucleic Acids Res., 28:219-221 (2000); doi: 10.1093/nar/28.1.219 Full text; Lefranc, M.-P., Nucleic Acids Res., 29:207-209 (2001); doi: 10.1093/nar/29.1.207 Full text; Lefranc, M.-P., Nucleic Acids Res., 31:307-310 (2003); doi: 10.1093/nar/gkg085 Full text; Lefranc, M.-P. et al., In Silico Biol., 5, 0006 (2004) [Epub], 5:45-60 (2005); Lefranc, M.-P. et al., Nucleic Acids Res., 33:D593-597 (2005); doi: 10.1093/nar/gki065 Full text; Lefranc, M.-P. et al., Nucleic Acids Res., 37:D1006-1012 (2009); doi: 10.1093/nar/gkn838 Full text; Lefranc, M.-P. et al., Nucleic Acids Res., 43:D413-422 (2015); doi: 10.1093/nar/gku1056 Full text.
For any other use please contact Marie-Paule Lefranc Marie-Paule.Lefranc@igh.cnrs.fr.

CNRS Université de Montpellier European Commission
IMGT® Founder and Executive Director Emeritus:
Marie-Paule Lefranc Marie-Paule.Lefranc@igh.cnrs.fr
IMGT® Director:
Sofia Kossida Sofia.Kossida@igh.cnrs.fr
Bioinformatics manager:
Véronique Giudicelli Veronique.Giudicelli@igh.cnrs.fr
Computer manager:
Patrice Duroux Patrice.Duroux@igh.cnrs.fr
Webmaster:
Amélie Houles

Citing IMGT | Warranty disclaimer and copyright notice | Privacy policy and advertisement policy

© Copyright 1995-2017 IMGT®, the international ImMunoGeneTics information system®