Protein display: Platypus IGH C-REGIONs

The IGHC protein display numbering is according to the IMGT unique numbering for C-DOMAIN and C-LIKE-DOMAIN.

Letters in red correspond to amino acids which are polymorphic in the other alleles.
For C-REGIONs, letters in bold correspond to additional positions in the IMGT unique numbering.
For C-REGIONs, letters between parentheses correspond to amino acids resulting from the splicing.

N (Asn, asparagine) of potential N-glycosylation sites (NXS/T, where X is different from P), (N-linked glycosylation) is shown is green (site is underlined in CHS and in pages edited before 14/10/2009).

The hinge exon(s) are shown at the end of the protein display.

_____________________________________________________________________________________________________________________________________________________________________________________________

      IGHC
      genes
_____________________________________________________________________________________________________________________________________________________________________________________________
                                         A        AB     B          BC         C      CD     D          DE           E      EF   F            FG          G             CHS
                                  -------------->   ---------->             ------>       ------->              ----------->  ------->               ---------->
                                  1       10   15  16  20 23      30      36 39 41 45      77     84             85  89     96 97    104    110      118  121    130       140       150
                           7654321|........|....|123|...|...... ...|.AB....|  |.....|1234567|......|12345677654321|..........|12|....... .....|....... ..|.........|.........|.........|
  CH1
  AY055778      ,IGHA1  c  (V)DPKSPPVVFPLETCSSEN....QDPVVVACLVK GIFP....MPGV  VYWDSDQASS....FTRTYNSIQSTGG......SFSFVSQLTMLSSQC..PLEKEFHC TAIYNN..LKATA NVT  
  NW_001794226  ,IGHA2      (A)TKTAPTIFPLNAYGSNS....EEQVSIGCLVR GYFP....EPVE  VTWGNQASSA....VKTYPAVLESNG.......YYLVSSMLTLPANQC..PDDKTYQC NVKHY...DSSKT ANVKCR
  NW_001794226  ,IGHD       (V)GQRAPEVYPLYAGCGSPAPA.EDKVTLVCLAT NFSP....NDLA  FTWNIKDDVK....NFPSVRRSDMT.........YIESSQLTFPASKW...DSETPTC TVKHN...QQKEK KIIVFKRQ
  NW_001794226  ,IGHE       (V)SSKAPSVFPLVPCCDGTD...SSAVTLGCLVT GYIP....EPVT  VRWNSGDLVK....GVTTFPSVFDSQS.....GLYTMSSQVTVSQESW...QSQTFTC NVEQTATKTKINT EVYS
  NW_001794226  ,IGHG1         (V)PPSIFPLTPSCKEEE...LSEVTVGCLVT GYSP....QPVH  VKWSPPAFSS....SSKTFPAVLQSG......GLYTLSSQITLPTEKW...RSESVTC NVEHPA..SKTKI DKKV
  NW_001705893  ,IGHG2      (A)AKVSPTVYPLIPSRKEKN...LSQVTLGCLVT GYFP....EPVS  IKWSPETFSS....NSKTFPAILQPS......GLYTLSSQITVPEDNW...CGELFTC SVEHPA..TQKNT QKTV
  NW_001794226  ,IGHM       (A)SQQAPLLFPLVPSCGDSLNQ.ESSLAVGCLAK NFLP....NSIT  LSWDFKNRTTVG..TEKFINYPTVLSG.....QAYSTTSQLMISATEVMMGQDDYVFC KAKHA....VGNK EIRVPLR
  NW_001794226  ,IGHO       (V)WKVAPSVFPLTPSCEEVE...LSEVTLGCLVT GYSP....DPVK  VDWSPSFYNS....KAQTYPSILHPT......GLYSLSSKITVPAYNW...HNKVYTC KVTHTP..TNTII SGNV
   CH2
  AY055778      ,IGHA1  c     CCKCSPKVLLHPPSLEGLFL..GKGANLTCVLK GLVDP...RETT  FTWTRPNGDP....SQATTGNPVEEED.....GTYSLASVLEICAEEW..HQRDKFTC TVTHPK...MSPI TQTITKPP
  NW_001794226  ,IGHA2      CCSNCPSVSVSLHPPSLESLFL..DKGANLTCELT GVSNV...KGVN  FTWSPLSGTA....RPVDGPAVKDDK......GKYTITSTLEVCTDEW..MRGDKYTC TVSHPE..LPKPV TKTITKVS
  NW_001794226  ,IGHD      (D)QRMQPPRVHLLPPPCVGTSE..GGTVELICLLL QFKP....NSTE  VQWLLNGRELNK..PAPTLFAADQDG.......SFMARSLLRISSSNW..EGGDTFTC RVTHPA..LKEGP ELYNSSKCS
  NW_001794226  ,IGHE    (D)CSKDPIPPTVKLLHSSCDPRGDS.QASIELLCLIT SYSP....AGIQ  VDWLVDGQKAEN..LFPYTAPPKREGN.....RSFSSHSEVNITQDQW..LSGKTFTC QVTHLA..DKKTY QDSARKCA
  NW_001794226  ,IGHG1         (S)SAAVFIFPPKPKDFLSV.AGTPKVTCVVV DLGFEDKDESPV  VTWYQGDKELP...KTRMLEPPPKEQR....NGTYRFVSERDVSSKDW..LDQKVFKC KVQHKN..FPSPI TKSISHTA
  NW_001705893  ,IGHG2       (V)LCGPAVFLVPPRPKDLLSE.GGKPKIICVAT GLRDE..EKDAR  VKWYKNGTLFP...NSQNAQTSSDTIW.....NGTRVSSKLSVTPEDW..KSDAEFRC EVEHKL..FPTSL KKAISHDK
  NW_001794226  ,IGHM      (V)AQPSRPNVSLHIPTREEFLGP.ELEGTIICQAK HFNP....KEIS  LKWLKNGELLNG..GFTTEGPTLDGS......KTYQLSSSLTVSDTDW..FKATDFTC VVEHP....KTHF IEMRNASYKCAG
  NW_001794226  ,IGHO  (1) VTPAMKSPPAVRVVHSSCLPNGDA.EATIQLLCLIS DFSP....AKIE  VKWLEDDEEQDG..FYVSESKRENNG.......KFSAYSEFNITQGEW..LTGKTFTC SVRHMA..SKKDI QDYARSCK
  CH3
  AY055778      ,IGHA1  c   (G)PLNRPEVHLLAPSTEELAL..NEMATLTCLVR GFNP....PDLL  VKWLKGGQEVSQT.DYVTSSPQREASEG..SASTFFLYSTLRVPTSEW..KEGENYSC VVGHEA.LPLNFT QKTIDHST...GKPSTVNVSLVMSDTAGTCY
  NW_001794226  ,IGHA2      (G)PLFRPEVHLLAPTAEELAL..NELATLTCLVR GFSP....KELM  VKWLKGGQEVPRK.DYVTGSPQREVSEG...SATFFLYSTLRVQTSTW..KEGENFSC VVGHES.LPLNFT QKTFDHST...GKPSTVNLTVVMSDAANTCY
  NW_001794226  ,IGHD    (A)CHSHATAMTLYLFAPSYDELVRG.NGKGHATCLVL GYDL....ASVQ  ISWQVNGVVTEGQ.TGVTRHESNGTES.....RTSTQTISLADWKA......GRRYIC RAKHPCVKEVTQE LSTFDP   
  NW_001794226  ,IGHE      (D)SDPRGITVFLTPPSPTDLYI..SKTPKLTCLII DLVST...EGME  VTWSRESGTPL...SAESFEEQKQFN......GTMSFISTVPVNIQDW..NEGESYTC RVAHPD..LPSPI IKTVTKLP
  NW_001794226  ,IGHG1      (G)TRKAPEAYVFPPHRDEMN...KNSVSITCLVL DFYP....DAIA  IDWQHNDRPVP...EGDYATTLPQKN.....GNSYFLYSKLTVQKTEW..NQGGSFTC SVRHEA.LPQKFL QKTVSKTS...GK
  NW_001705893  ,IGHG2     (N)TERKTPEAYIFSPHTEELS...KESVSITCLVK GFLP....QDIS  IAWQHKGKEMK...EEEYSTTPPQYR.....NGSYFLYSKLTVTKKDW..ETGESFSC LVYHDS..RSDTL KKTVSKNT...GN
  NW_001794226  ,IGHM       (V)PSSSIKISTTPPSFAGIFT..TKSAKLVCSVT GMSTS...DSLS  IVWTQYEGKEL...TTKTSVSKIQPD......GTFSATGEASVCAEDW..QSGKRFTC TVSHAD..LPAPQ SAYISKQK
  NW_001794226  ,IGHO     (D)INLIQNLKVSVSPPNPTDLFI..ARTPSLTCLVA SLPDS...EGIK  LQWIHKGIER....PASPIKIMKQPD......GTFSAESTLSITLPEW..MEGESFTC KVQHPD.FPSIVE KAISKPL
  CH4
  NW_001794226  ,IGHD     (K)TPTKKPSVSVSRVFSEDSPGE..EDHPTLLCNIR GFYP....KELS  VSWENNSHPLP...RTLYSSGPVVAT.....GNEAFSTYSLLRVGPGE...RGGAYTC VVMHPS.TDRPTR SNKVSF
  NW_001794226  ,IGHE       (G)KRLAPEVYAFPPHQAEVSH..GDSLSLTCLIR GFYP....ENIS  VRWLLDNKPLPTE.HYRTTKPLKDQGP....DPAYFLYSRLAVNKSTW..EQGNVYTC QVVHEALPSRNTE RKFQHTS....GN
  NW_001794226  ,IGHM      (E)VNLHSPAVYVLPPASDQLSL..RESATLSCLVK SFSP....ADVM  VQWLHKGQPVPQD.KYTVSAPMPEPQS....PNLYFAYSTLTVAEEEW..SAGDSFTC VVVHEA.LPLYVM ERTVDKST...GKPTHINVSLVMSDTANTCY
  NW_001794226  ,IGHO       (G)KSLAPAVYVFPPHMDELAQ..KDTLSLTCLAK SFFP....ADIA  VQWLHNDEDVEED.HFSVTKPQKDLTG....QGTFFLYSKLDIQKSNW..KRGDSFTC MVGHEALKRYSI. QKTVRQNP...GK
  CH5
  NW_001794226  ,IGHD     (D)WALSRAPEVSITGHPACNAPG..AETSVFRCSAS NFFP....AGAE  ILWLVKGQEQPG..LTQTITRSRDGR........YSASLELSVPNAQW..NQLAEFTC RVSHAG..ATQQK NLSKCA
  CH6
  NW_001794226  ,IGHD    (V)CQDSTPQPTLYLLPPPLEGLVL..RAEALLTCLVV GYQL....DQAT  LTWEVDKKPLAG..SPSVRALVTHDN......GTQSLRSHLNLSRTDW..EAAHTVLC RVSHRC..LFAPQ EETLQPLR
  CH7
  NW_001794226  ,IGHD     (G)ADPPRKLSIHVLHPSLPQSSA..EASAWLLCEVS NFSP....AEIF  LTWWENETSVSPS.WFTTTAPFAQPGN.....AMYSTQSLLRIPASQG..HMASTYTC MVGHVSSPSMLNI SRNGVF   
  CH8
  NW_001794226  ,IGHD         (D)FLEPARPLVTAFHEPSG..SSREKLVCLAT DFRP....KDID  MKWEVRGQERRC..SDSLPSKALGNG.......MFQQSCALLLSLEEW..TQPETYTC VVNHSS..DTAAV RRELTST
  CH9
  NW_001794226  ,IGHD      (Q)CPAWSPTAHTLPPSFEWLLQ..NETVVLTCVTD MF.......NAS  VEWTAGEELAAL..ETVENKKEKFPN......GSSWLFSQLKVNFSVW..NSTESFSC QVKDGQ..SELRV NVTHIP 
  CH10
  NW_001794226  ,IGHD       (G)PVKAPKVYLFPPPTEEMSR..GPSLTLVCLIK DFYP....ASIL  VQWQEGSAVLETQAAQSQNPSCDHQS......RRCSAVSKLEIPKSRW..MARTRYHC QVFHIS..RRGIL IRNASTHY (D)HPAEDSGS
  M
  NW_001794226  ,IGHA2 (G)PECYCPTTVACCSFPKLPVVDEGGVEETDQESTLWPTSVTFLTLFLLSLFYSTTVTLFKVKPLSPIKY
                                                     M1                                M2
  NW_001794226  ,IGHD           (D)PRVIDFTFKDENNDDYTEMDESNNVWPTVSTFVALFLLTLLYSGFVTFIK  VK
  NW_001794226  ,IGHE                  (D)LIREDDCSEAENEELDGLWTTIYVFITLFLLSVGYSATVTLFK  VKWIFATVLQLKRSNVHDYKNMIQQGA
  NW_001794226  ,IGHG1                 (E)LILDENCAEAGDEELEGLWTTISVFITLFFLSVCYSATVTLFK  VKWIFSTVVDLKPQMLPDYRNMIDQGA
  NW_001705893  ,IGHG2                 (G)LILDENCTEADSEELEGLWTTISVFITLFFLSVCYSATITLFK  VKWIYSSVVQLKPQMLPDYRNMINHEV
  NW_001794226  ,IGHM                       (E)GEVNAEEEGFENLWTTASTFIVLFLLSLFYSTTVTLFK  VK
  NW_001794226  ,IGHO                  (G)LIPGENCTEAGDGELDGLWTTISIFITLFLLTVCYSATITLVK  VRWLFSSMMQIKQTRSIHNYRNMILPGA
                                      CONNECTING-REGION    | TRANSMEMBRANE-REGION      | CYTOPLASMIC-REGION
  Hinge
  AY055778      ,IGHA1       (C)PPVPQ
  NW_001794226  ,IGHA2       (S)PVSNCGCE
  NW_001794226  ,IGHG1       (E)PGPSNPPHCP
  NW_001705893  ,IGHG2       (G)PRFPGSNSCP
  NW_001794226  ,IGHO        (V)APAPPTPQTTTPV

c: cDNA sequence


IMGT notes:
(1)The determination of CH2 is arbitrarily based on the 5' delimitation of IGHE CH2.