Protein display: Sheep (Ovis aries) IGH C-REGIONs

The IGHC protein display numbering is according to the IMGT unique numbering for C-DOMAIN and C-LIKE-DOMAIN.

Letters in red correspond to amino acids which are polymorphic in the other alleles.
For C-REGIONs, letters in bold correspond to additional positions in the IMGT unique numbering.
For C-REGIONs, letters between parentheses correspond to amino acids resulting from the splicing.

N (Asn, asparagine) of potential N-glycosylation sites (NXS/T, where X is different from P), (N-linked glycosylation) is shown is green (site is underlined in CHS and in pages edited before 14/10/2009).

The hinge exon(s) are shown at the end of the protein display.
_____________________________________________________________________________________________________________________________________________________________________________________________

      IGHC
      genes
_____________________________________________________________________________________________________________________________________________________________________________________________
                                         A        AB     B          BC         C      CD     D          DE           E      EF   F            FG          G             CHS
                                  -------------->   ---------->             ------>       ------->              ----------->  ------->               ---------->
                                  1       10   15  16  20 23      30    36 39 41 45      77     84             85  89     96 97    104    110      118  121    130       140       150
                           7654321|........|....|123|...|...... ...|.....|  |.....|1234567|......|12345677654321|..........|12|....... .....|....... ..|.........|.........|.........|

  CH1
  AF024645,IGHA    c        (E)SEASPSIFPLSLGNEDP....AGQVVIGCLVQ GFFPS.APLS  VTWNQSGDNV....SVRNFPAVLAGS.......QYTMSSQLTLPASLC..PKDKSVTC QVQHL...SKASK TVDVPCKLE
  M84356  ,IGHE    c        (V)SSQHPSIYPLRTCCIK.....ETSVALGCLVK DYFP..GSVA  VTWDTAPLDG....STLTFPSIQMANS.....SLYVTTSQLTVSGE.....QPKQFTC SVFHAE..TNTTA MKTVST
  X69797  ,IGHG1   c        (A)STTPPKVYPLTSCCGDTS...SSIVTLGCLVS SYMP..EPVT  VTWNSGALTS....GVHTFPAILQSS......GLYSLSSVVTVPASTS...GAQTFIC NVAHPA..SSTKV DKRV
  X70983  ,IGHG2   c        (A)STTAPKVYPLTSCCGDTSSS.SSIVTLGCLVS SYMP..EPVT  VTWNSGALTS....GVHTFPAILQSS......GLYSLSSVVTVPASTS...GAQTFIC NVAHPA..SSAKV DKRV
  L04260  ,IGHM    c (m)    (E)SESHPKVFPLVSCVSSPSD..ENTVALGCLAR DFVP..NSVS  FSWKFNNSTVSSE.RFWTFPEVLRDG.......LWSASSQVALHSSSTFQGTDGYLVC EVQHPK.GGKTVG TVMVVAP
  CH2
  AF024645,IGHA    c            NCEPSLSLQPPALEDLLL..SSNASLTCTLR GLKSA.KGAS  FTWSPTGGKT....AVQGLPERDSCG.......CYSVSSVLPGCADPW..NSGQTFSC SATYP....DGSL TTTIKKDL
  M84356  ,IGHE    c     (E)CAKNFSDPSVRLFYSSCDPSGDT.HTTIQLLCRIS GYTP..GKIK  VTWLVDGHESKE..LYAQPGPEIQEG......NLTTTYSEVNITQGQW..ASEKTYTC RVNYY....GFNF DNHARRCTA
  X69797  ,IGHG1   c       (P)ELPGGPSVFIFPPKPKDTLTI.SGTPEVTCVVV DVGQDDPEVQ  FSWFVDNVEVR...TARTKPREEQFN......STFRVVSALPIQHQDW..TGGKEFKC KVHNEA..LPAPI VRTISRTK
  X70983  ,IGHG2   c          (V)SRPSVFIFPPKPKDSLMI.TGTPEVTCVVV DVQGD.PEVQ  FSWFVDNVEVR...TARTKPREEQFN......STFRVVSALPIQHDHW..TGGKEFKC KVHSKG..LPAPI VRTISRAK
  X59994  ,IGHM    c       (E)VEVLSPVVSVFVPPCNSLSGNGNSKSSLICQAT DFSP..KQIS  LSWFRDGKRIVS..DISEGQVETVQSS....PTTYRAYSVLTITEREW..LSQSAYTC QVEHN....KETF QKNASSSCDA
  CH3
  AF024645,IGHA    c        (V)NTFRPQVHLLPPPSEELAL..NELVTLTCLVR GFSP..RDVL  VRWLQGNQELPRE.KYLTWGPLPEPGQS...VTTFAVTSVLRVDAEVW..KQGDTFSC MVGHEA.LPLAFT QKTIDRLA...GKPTHVNVSVVMSEVDGVCY
  M84356  ,IGHE    c       (E)SEPRGVSTYLIPPTPLELYV..NKSPKITCLVV DLAST.NNLS  LTWSRANGKPV...HADPLDIKHQFN......GTITVTSTLPVNVIDW..VEGETYYC KVSHGD..LPKDI QRSISKDV
  X69797  ,IGHG1   c        (G)QAREPQVYVLAPPQEELS...KSTLSVTCLVT GFYP..DYIA  VEWQKNGQPESED.KYGTTTSQLDAD......GSYFLYSRLRVDKNSW..QEGDTYAC VVMHEA.LHNHYT QKSISKPP...GK
  X70983  ,IGHG2   c        (G)QAREPQVYVLAPPQEELS...KSTLSVTCLVT GFYP..DYIA  VEWQRARQPESED.KYGTTTSQLDAD......GSYFLYSRLRVDKSSW..QRGDTYAC VVMHEA.LHNHYT QKSISKPP...GK
  X59994  ,IGHM    c        (T)PPSPIGVFTIPPSFADIFL..TKSAKLSCLVT NLASY.DGLN  ISWSHQNGKAL...ETHTYFERHLND.......TFSARGEASVCSEDW..ESGEEYTC TVAHLD..LPFPE KSAISKPK
  CH4
  M84356  ,IGHE    c        (G)KRVAPKVYVFWPDRKELEN..QEELTLTCLIQ KFFP..KDIS  VRWLRNKELMREG.QHTTTQPDRADNN....SLAFFAYSRLAVPKASW..KMDDEFTC QVIHEALPKTRTL EKSVFINS...GK
  X59994  ,IGHM    c       (D)VAMKPPSVYVLPPTREQLSL..RESASVTCLVK GFAP..ADVF  VQWLQKGEPVAKS.KYVTSSPAPEPQD....PSAYFVHSILTVTEEDW..SKGETYTC VVGHEA.LPHMVT ERTVDKST...GKPTLYNVSLVMSDTASTCY
  Hinge
  AF024645,IGHA    c         (C)PCPEECLPL
  X69797  ,IGHG1   c         (E)PGCPDPCKHCRCPP
  X70983  ,IGHG2   c         (G)ISSDYSKCSKPPC
                                         M1                             M2
  L04260  ,IGHM    c (m)     (E)GEVSAEEEGFENLNTMASTFIVLFLLSLFYSTTVTLFK  VK
                           CONNECTING-REGION| TRANSMEMBRANE-REGION      | CYTOPLASMIC-REGION
c: cDNA sequence
(m): transcript of a secreted chain.


Created: 01/07/2002
Last updated: Friday, 27-May-2016 21:03:33 CEST
Authors: Christèle Martinez-Jean and Nathalie Bosc

Software material and data coming from IMGT server may be used for academic research only, provided that it is referred to IMGT®, and cited as "IMGT®, the international ImMunoGeneTics information system® http://www.imgt.org (founder and director: Marie-Paule Lefranc, Montpellier, France)." References to cite: Lefranc, M.-P. et al., Nucleic Acids Res., 27:209-212 (1999); doi: 10.1093/nar/27.1.209 Full text Cover; Ruiz, M. et al., Nucleic Acids Res., 28:219-221 (2000); doi: 10.1093/nar/28.1.219 Full text; Lefranc, M.-P., Nucleic Acids Res., 29:207-209 (2001); doi: 10.1093/nar/29.1.207 Full text; Lefranc, M.-P., Nucleic Acids Res., 31:307-310 (2003); doi: 10.1093/nar/gkg085 Full text; Lefranc, M.-P. et al., In Silico Biol., 5, 0006 (2004) [Epub], 5:45-60 (2005); Lefranc, M.-P. et al., Nucleic Acids Res., 33:D593-597 (2005); doi: 10.1093/nar/gki065 Full text; Lefranc, M.-P. et al., Nucleic Acids Res., 37:D1006-1012 (2009); doi: 10.1093/nar/gkn838 Full text; Lefranc, M.-P. et al., Nucleic Acids Res., 43:D413-422 (2015); doi: 10.1093/nar/gku1056 Full text.
For any other use please contact Marie-Paule Lefranc Marie-Paule.Lefranc@igh.cnrs.fr.

CNRS Université de Montpellier European Commission
IMGT® Founder and Executive Director Emeritus:
Marie-Paule Lefranc Marie-Paule.Lefranc@igh.cnrs.fr
IMGT® Director:
Sofia Kossida Sofia.Kossida@igh.cnrs.fr
Bioinformatics manager:
Véronique Giudicelli Veronique.Giudicelli@igh.cnrs.fr
Computer manager:
Patrice Duroux Patrice.Duroux@igh.cnrs.fr
Webmaster:
Amélie Houles

Citing IMGT | Warranty disclaimer and copyright notice | Privacy policy and advertisement policy

© Copyright 1995-2017 IMGT®, the international ImMunoGeneTics information system®