IMGT reference sequences in FASTA format:

Amino acid sequences with gaps

The FASTA header contains:
IMGT accession number | gene and allele name | species | functionality | exon name | domain name | domain type | alternative splicing (if it is) | partial (if it is)
>AL355312|RAET1E*01|Homo sapiens|F|EX1||
MRRISLTSSPVRLLLFLLLLLIALEIMV
>AL355312|RAET1E*01|Homo sapiens|F|EX2|[D1]|G-LIKE-ALPHA1||
.....GHSLCFNFTIKSLSRPGQPWCEAQVFLNKNLFLQYNSDNNMVKPLGLL.......
.GKKVYAT..STWGELTQTLGEVGRDLRMLLCDIKPQIKTS
>AL355312|RAET1E*01|Homo sapiens|F|EX3|[D2]|G-LIKE-ALPHA2||
.....PSTLQVEMFCQREAER.CTGASWQFATNGEKSLLFDAMNMTWTVINHEA......
.SKIKET.WKKDRGLEKYFRKLSKGDCDHWLREFLGHWEAMPEPT
>AL355312|RAET1E*01|Homo sapiens|F|EX4||
SPVNASDIHWSSSSLPDRWIILGAFILLVLMGIVLICVWWQNGEWQAGLWPLRTS*
>AL355312|RAET1E*01|Homo sapiens|F|EX1|splicing B|
MRRISLTSSPVRLLLFLLLLLIALEIMV
>AL355312|RAET1E*01|Homo sapiens|F|EX2|[D1]|G-LIKE-ALPHA1|splicing B|
.....GHSLCFNFTIKSLSRPGQPWCEAQVFLNKNLFLQYNSDNNMVKPLGLL.......
.GKKVYAT..STWGELTQTLGEVGRDLRMLLCDIKPQIKTS
>AL355312|RAET1E*01|Homo sapiens|F|EX3|[D2]|G-LIKE-ALPHA2|splicing B|
.....PSTLQVEMFCQREAER.CTGASWQFATNGEKSLLFDAMNMTWTVINHEA......
.SKIKET.WKKDRGLEKYFRKLSKGDCDHWLREFLGHWEAMPEPT
>AL355312|RAET1E*01|Homo sapiens|F|EX4|splicing B|
GRRST*
>AY252119|RAET1E*02|Homo sapiens|F|EX1||
MRRISLTSSPVRLLLFLLLLLIALEIMV
>AY252119|RAET1E*02|Homo sapiens|F|EX2|[D1]|G-LIKE-ALPHA1||
.....GHSLCFNFTIKSLSRPGQPWCEAQVFLNKNLFLQYNSDNNMVKPLGLL.......
.GKKVYAT..STWGELTQTLGEVGRDLRMLLCDIKPQIKTS
>AY252119|RAET1E*02|Homo sapiens|F|EX3|[D2]|G-LIKE-ALPHA2||
.....PSTLQVEMFCQREAER.CTGASWQFATNGEKSLLFDAMNMTWTVINHEA......
.SKIKET.WKKDRGLEKYFRKLSKGDCDHWLREFLGHWEAMPEPT
>AY252119|RAET1E*02|Homo sapiens|F|EX4||
SPVNASDIHWSSSSLPDRWIILGAFILLVLMGIVLICVWWQNGEWQAGLWPLRTS*
>AF359243|RAET1E*03|Homo sapiens|F|EX1||
MRRISLTSSPVRLLLFLLLLLIALEIMV
>AF359243|RAET1E*03|Homo sapiens|F|EX2|[D1]|G-LIKE-ALPHA1||
.....GHSLCFNFTIKSLSRPGQPWCEAQVFLNKNLFLQYNSDNNMVKPLGLL.......
.GKKVNAT..STWGELTQTLGEVGRDLRMLLCDIKPQIKTS
>AF359243|RAET1E*03|Homo sapiens|F|EX3|[D2]|G-LIKE-ALPHA2||
.....PSTLQVEMFCQHEAER.CTGASWQFTINGEKSLLFDAMNMTWTVINHEA......
.SKIKET.WKKDRGLEKYFRKLSKGDCDHWLREFLGHWEAMPEPT
>AF359243|RAET1E*03|Homo sapiens|F|EX4||
SPVNASDIHWSSSS*
>AY054974|RAET1E*04|Homo sapiens|F|EX1|splicing C|
MRRISLTSSPVRLLLFLLLLLIALEIM.
>AY054974|RAET1E*04|Homo sapiens|F|EX2|[D1]|G-LIKE-ALPHA1|splicing C|
.......................................YNSDNNMVKPLGLL.......
.GKKVNAT..STWGELTQTLGEVGRDLRMLLCDIKPQIKTS
>AY054974|RAET1E*04|Homo sapiens|F|EX3|[D2]|G-LIKE-ALPHA2|splicing C|
.....PSTLQVEMFCQREAER.CTGASWQFATNGEKSLLFDAMNMTWTVINHEA......
.SKIKET.WKKDRGLEKYFRKLSKGDCDHWLREFLGHWEAMPEPT
>AY054974|RAET1E*04|Homo sapiens|F|EX4|splicing C|
SPVNASDIHWSSSSLPDRWIILGAFILLVLMGIVLICVWWQNGEWQAGLWPLRTS*