IMGT reference sequences in FASTA format:

Amino acid sequences without gaps

The FASTA header contains:
IMGT accession number | gene and allele name | species | functionality | exon name | domain name | domain type | alternative splicing (if it is) | partial (if it is)
>AL355497|RAET1L*01|Homo sapiens|F|EX1|
MAAAAIPALLLCLPLLFLLFGWSRARRD
>AL355497|RAET1L*01|Homo sapiens|F|EX2|[D1]|G-LIKE-ALPHA1|
PHSLCYDITVIPKFRPGPRWCAVQGQVDEKTFLHYDCGNKTVTPVSPLGKKLNVTMAWKA
QNPVLREVVDILTEQLLDIQLENYTPK
>AL355497|RAET1L*01|Homo sapiens|F|EX3|[D2]|G-LIKE-ALPHA2|
PLTLQARMSCEQKAEGHSSGSWQFSIDGQTFLLFDSEKRMWTTVHPGARKMKEKWENDKD
VAMSFHYISMGDCIGWLEDFLMGMDSTLEPSAG
>AL355497|RAET1L*01|Homo sapiens|F|EX4|
PLAMSSGTTQLRATATTLILCCLLIILPCFILPGI*
>AL355497|RAET1L*01|Homo sapiens|F|
MAAAAIPALLLCLPLLFLLFGWSRARRDDPHSLCYDITVIPKFRPGPRWCAVQGQVDEKT
FLHYDCGNKTVTPVSPLGKKLNVTMAWKAQNPVLREVVDILTEQLLDIQLENYTPKEPLT
LQARMSCEQKAEGHSSGSWQFSIDGQTFLLFDSEKRMWTTVHPGARKMKEKWENDKDVAM
SFHYISMGDCIGWLEDFLMGMDSTLEPSAGAPLAMSSGTTQLRATATTLILCCLLIILPC
FILPGI*