IMGT reference sequences in FASTA format:

Amino acid sequences without gaps

The FASTA header contains:
IMGT accession number | gene and allele name | species | functionality | exon name | domain name | domain type | alternative splicing (if it is) | partial (if it is)
>M13733|CD79A*01|Mus musculus|F|EX1|
MPGGLEALRALPLLLFLSYACL
>M13733|CD79A*01|Mus musculus|F|EX2|[D1]|C-LIKE|
GPGCQALRVEGGPPSLTVNLGEEARLTCENNGRNPNITWWFSLQSNITWPPVPLGPGQGT
TGQLFFPEVNKNTGACTGCQVIENNILKRSCGTYLRVR
>M13733|CD79A*01|Mus musculus|F|EX3|
NPVPRPFLDMGEGTKNRIITAEGIILLFCAVVPGTLLLFR
>M13733|CD79A*01|Mus musculus|F|EX4|
KRWQNEKFGVDMPDDYEDENLYE
>M13733|CD79A*01|Mus musculus|F|EX5|
GLNLDDCSMYEDISRGLQGTYQDVGNLHIGDAQLEKP
>CD79A*01|Mus musculus|F|EX1-5|Complete|Splicing A|
MPGGLEALRALPLLLFLSYACLGPGCQALRVEGGPPSLTVNLGEEARLTCENNGRNPNIT
WWFSLQSNITWPPVPLGPGQGTTGQLFFPEVNKNTGACTGCQVIENNILKRSCGTYLRVR
NPVPRPFLDMGEGTKNRIITAEGIILLFCAVVPGTLLLFRKRWQNEKFGVDMPDDYEDEN
LYEGLNLDDCSMYEDISRGLQGTYQDVGNLHIGDAQLEKP