Only the *01 allele of each functional, ORF and in-frame pseudogene V-REGION is shown.
Dots indicate gaps according to the IMGT unique numbering. Blanks at the 5' and/or 3' end indicate partial sequences.
Spectacled caiman (Caiman crocodilus) gene names are provisional. Definitive gene nomenclature will be assigned once the complete genomic sequence of the caiman IGH locus will be made publicly available.
___________________________________________________________________________________________________________________________________________________ IGHV FR1-IMGT CDR1-IMGT FR2-IMGT CDR2-IMGT FR3-IMGT CDR3-IMGT gene (1-26) (27-38) (39-55) (56-65) (66-104) (105-115) __________________________ __________________________ ____________ _________________ __________ _______________________________________ ___________ 1 10 20 30 40 50 60 70 80 90 100 110 .........|.........|...... ...|........ .|.........|..... ....|..... ....|.........|.........|.........|.... .....|..... M34918,IGHV1S1*01 QVQLVESGG.DVRKPGNSLRLSCKAS GFTFGGYG.... MFWVRQAPGKGLDWVAT INTDGSSQ.. WYSPAVQ.GKFTISRGNSQNMLYLQMSSLTPEDTATYYC AR......... M12769,IGHV1S2*01 QVQLVESGG.DVRKPGDSLRLSCKGS GFTFSNYW.... LGWVRQAPGKALNGSLP LTPLAAAP.. TYIPGVS.GRFTISRDNARALLHLDMSDLRPEDTGRYHC ER......... M12770,IGHV1S3*01 EIQLVESGG.AIRKPGDSLRLSCKAS GFTFSDTW.... MAWARQPPGKGLQWVGE INGNSETI.. RYAPEVK.GRLTISRDNTQNLLFLQISSLKPEDTATYYC AR.........
Created: Wednesday, 29-Jun-2011 17:05:54 CEST
Author: Delphine Guiraudou
Contact: Marie-Paule Lefranc
Software material and data coming from IMGT server may be used for academic research only, provided that it is referred to IMGT®, and cited as "IMGT®, the international ImMunoGeneTics information system® http://www.imgt.org (founder and director: Marie-Paule Lefranc, Montpellier, France)." References to cite: Lefranc, M.-P. et al., Nucleic Acids Research, 27, 209-212 (1999) Cover of NAR; Ruiz, M. et al., Nucleic Acids Research, 28, 219-221 (2000); Lefranc, M.-P., Nucleic Acids Research, 29, 207-209 (2001); Lefranc, M.-P., Nucleic Acids Res., 31, 307-310 (2003); Lefranc, M.-P. et al., In Silico Biol., 5, 0006 (2004) [Epub], 5, 45-60 (2005); Lefranc, M.-P. et al., Nucleic Acids Res., 33, D593-D597 (2005) Full text; Lefranc, M.-P. et al., Nucleic Acids Research 2009 37: D1006-D1012; doi:10.1093/nar/gkn838 Full text.
|
IMGT founder and director: Marie-Paule Lefranc
Marie-Paule.Lefranc@igh.cnrs.fr
Bioinformatics manager: Véronique Giudicelli Veronique.Giudicelli@igh.cnrs.fr Computer manager: Patrice Duroux Patrice.Duroux@igh.cnrs.fr Webmaster: Chantal Ginestoux Chantal.Ginestoux@igh.cnrs.fr |
|
|
|
|
Citing IMGT © Copyright 1995-2012 IMGT®, the international ImMunoGeneTics information system® |
|||
